SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001876 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001876
Domain Number 1 Region: 589-846
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.54e-89
Family Eukaryotic proteases 0.00000743
Further Details:      
 
Domain Number 2 Region: 336-442
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.5e-28
Family Spermadhesin, CUB domain 0.00061
Further Details:      
 
Domain Number 3 Region: 226-330
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.3e-19
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 4 Region: 519-555
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000103
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 5 Region: 483-518
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000128
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 6 Region: 443-483
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000012
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 7 Region: 81-165
Classification Level Classification E-value
Superfamily SEA domain 0.000000262
Family SEA domain 0.0076
Further Details:      
 
Domain Number 8 Region: 559-600
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000323
Family LDL receptor-like module 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001876   Gene: ENSTNIG00000002566   Transcript: ENSTNIT00000003846
Sequence length 849
Comment pep:novel chromosome:TETRAODON8:Un_random:52992926:52998684:1 gene:ENSTNIG00000002566 transcript:ENSTNIT00000003846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKSRRARVKVLLPVSQMEDWDTTLHFLPATDTKPLEKMSGRRKKLWMGLGLLLLAAAVAL
TTGLLVWHFNAVSDVRVERLYIGAMGLRDQPFLKSYEEPSSPQFDQLASLVCQQLETMFS
RNSVLAKSFSGCTVQSFSEGTGATRTVAYYQSQFEVHVSQQASLDEAVQSMQLLLGDPDG
HKGRLQLRPADRLSVSNVMAQAVDPRTTRSSLFVKKTFNIHVREKGDVRSPGFPGSSYPP
NVYLQWRLRADPGHRIQLDFQTLILDDDCQQDFIRIYDSLAPLEHRVLTEQCGYPHGSLS
FLSSGHVMLLTLLTNEERNFPGFIANYSQIPLSRASCGGRLRGDRGFLSSPFYPAHYPPQ
TSCVWEIQATKDQFVKVQFNTFLLGNGSDGCPGDYVEINGQRLCGRKPERTVVTSRSNTM
TVTFTSDASYVDQGFHAEYTAFVPTDPCPGSFWCHNNLCLNPALRCDGWDDCGDNSDERD
CQCDASQLRCQNGRCKPKFWQCDGTDDCGDNSDEDNCVKCKPGEFLCRNQRCVPESRRCD
GRDDCSDGSDESQCKRSVLLQQCSEHSFRCRNGKCISKLNPDCDGELDCEDASDEDGCHC
GKRPYRSSRIVGGQVSQEAEWPWQVSLHIKGTGHTCGASVLSNRWLLTAAHCVRNPGSAM
YSQPEQWEVLLGLHEQGQTSKWTVKRSVKQIIPHHRYDPVTYDNDIALMELDANVTLNQN
IYPICLPSPTYYFPVGSEAWITGWGATREGGRPASVLQKAAVRIINSTVCRSLMSDEVTE
GMLCAGLLRGGVDACQGDSGGPLSFTSPSGRVFLAGVVSWGDGCARRNKPGVYTRTTQYR
SWIREKSGV
Download sequence
Identical sequences H3C0W0
ENSTNIP00000001876 ENSTNIP00000001876 99883.ENSTNIP00000001876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]