SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001891 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001891
Domain Number 1 Region: 97-201
Classification Level Classification E-value
Superfamily C-type lectin-like 1.75e-26
Family C-type lectin domain 0.0023
Further Details:      
 
Domain Number 2 Region: 18-82
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000292
Family C-type lectin domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001891   Gene: ENSTNIG00000000577   Transcript: ENSTNIT00000001168
Sequence length 202
Comment pep:novel chromosome:TETRAODON8:Un_random:21032969:21034145:-1 gene:ENSTNIG00000000577 transcript:ENSTNIT00000001168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQPRHTSFSQFAQPEDELCTGFYAIRTEGLFDWSDQPSVRFISCTFGQPPVSTDAQDCAP
IPGQLFWNWAHRSCEEKHGFICMKQSATERTGDEVEVHIGCKVGWKRHGSYCYFIGTTMK
KFDEAKSDCEALGSYLADVSNGVDNAFLVSLVGFRPEKHFWLGLSNQKNIDEFVWTQGSG
VKYTHWNTGMPGYEQGCVAMTT
Download sequence
Identical sequences H3C0X5
99883.ENSTNIP00000001891 ENSTNIP00000001891 ENSTNIP00000001891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]