SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002035 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002035
Domain Number 1 Region: 24-104
Classification Level Classification E-value
Superfamily C-type lectin-like 2.8e-20
Family C-type lectin domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002035   Gene: ENSTNIG00000000045   Transcript: ENSTNIT00000002259
Sequence length 120
Comment pep:novel chromosome:TETRAODON8:Un_random:21031695:21032466:-1 gene:ENSTNIG00000000045 transcript:ENSTNIT00000002259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGMKPEIIAGPSEETCSVFTATENLYRYGRAWIGLYAPDPDTGYVWSDGSPVNFLHWQEG
EPNNHNNDESCAEFRIQNSWDPTGSWNDANCESYNDWLCQIRAGTDGIKCFYSSSAFWCL
Download sequence
Identical sequences H3C1B9
ENSTNIP00000002035 99883.ENSTNIP00000002035 ENSTNIP00000002035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]