SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002115 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002115
Domain Number 1 Region: 509-689
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-43
Family SPRY domain 0.0024
Further Details:      
 
Domain Number 2 Region: 165-230
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 3.66e-16
Family B-box zinc-binding domain 0.0000271
Further Details:      
 
Domain Number 3 Region: 2-88
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000198
Family RING finger domain, C3HC4 0.021
Further Details:      
 
Domain Number 4 Region: 374-423,467-514
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000173
Family Fibronectin type III 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000002115
Domain Number - Region: 112-162
Classification Level Classification E-value
Superfamily RING/U-box 0.00265
Family RING finger domain, C3HC4 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002115   Gene: ENSTNIG00000016779   Transcript: ENSTNIT00000000810
Sequence length 722
Comment pep:novel chromosome:TETRAODON8:1:7885241:7930357:1 gene:ENSTNIG00000016779 transcript:ENSTNIT00000000810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLESELTCPICLELFEDPLLLPCAHSLCFNCAHRILVSHCSSSKPLESISAFQCPTCR
YVITLNHRGLEGLKRNVTLQNIIDRFQKASLSGPNSPTESRRLQQQRPYTATISARISCQ
FCEQDPPREAVKTCVTCEVSYCDRCLRATHPNKKPFTSHRLVEPVPDTHIRGLTCLEHEN
EKVNMYCLVDDQLICALCKLVGRHREHQVSSLTERFDKLKQTLENNLTNLVKRNSELENQ
MAKLIQICQQVEVNTAMHEAKLVEECDELVEIIRQRKQVIAVKIKESKVMKLRKLAQQIA
NCRQCLERSSALITQAEQSLKENDHARFLQTARNVAERVAMATASSQVLIPDVNLNEAFD
NFALDFSREKKILEGLDYLTAPNPPTIREELCTASHDTITVHWTSEDEFSVTSYELQYTI
YTGQTNFISESHCANAIFFSLMGNKFGFVNKSYRLRGAPHSLYNSADSWMIVPNKQNHYT
VHGLQSGTRYIFFVKAINQAGSRNSEPARLKTNSQPFKLDPKTAHKKLRLSNDCLTMEKD
ESSLKKSHTPERFSGTGSYGAAGNVFIDSGCHYWEVLLGASTWYAIGVAYKSAPKNEWSG
KNSSSWVFTRCNNNFLVRHDGKEMLVEASLQLRRLGVLLDYDNNSLSFHDAMNSQHIHTF
EISFLLPVVPTFMIWNKSIMILSGLPVPDFVDGVPTDFQEQQQQMGLCRQESPYLTGMKT
CH
Download sequence
Identical sequences H3C1J9
99883.ENSTNIP00000002115 ENSTNIP00000002115 ENSTNIP00000002115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]