SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002383 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002383
Domain Number 1 Region: 516-706
Classification Level Classification E-value
Superfamily Sec7 domain 2.49e-65
Family Sec7 domain 0.00000428
Further Details:      
 
Domain Number 2 Region: 738-862
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000227
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002383   Gene: ENSTNIG00000007391   Transcript: ENSTNIT00000002957
Sequence length 958
Comment pep:novel chromosome:TETRAODON8:11:11620627:11626372:-1 gene:ENSTNIG00000007391 transcript:ENSTNIT00000002957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWCLRCSSNRSQSMLELESDGCVEGDAPGGEVGASADPSGGYSCVPVTHSAGLGPQHLDS
QLYGHVFLPGHQRPRRPKLQHSQSILRKQAEEEAIKRSRSLSESYELSSDLQDKQVEMLE
RKYGGRFITRHAARTIQTAFRQYQMNKNFERLRSSMSENRMSRRIVLSNMRMQFSFEGPE
KVHSSYFEGKQVSLTDDRTKLGARVQAEPAGEMCIQAKTPAPQSDFTDAITELEDAFSRQ
VKSLAESIDDALNCRSLHGDDGPTEPRRLHQEHQVQPSHSVSDHRKLDEMTASYSDVTLY
IDEEELSPPLPLPQPGEQPCSTEAGLHQRSLSASQDYWSLAHKEEKGDTDTSCRSTPSLE
CQEQRLRVDHLPLLTIEPPSDSSVELSDRSDRSSLKRQSAYERSLANQQSSPKHVSHGLP
PRGPSREEDAPLHRQRQLEAHLAINGTANRQSKSESDFSDGDNDSINSTSNSNDTINCSS
ESSSRDSLREQTLSKQTYHKETRNSWDSPAFSNDIIRKRHYRIGLNLFNKKPEKGIQYLI
ERSFVPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFTAMELDEA
LRKFQAHIRVQGEAQKVERLIEAYSQRYCICNPGVVRQFRNPDTIFILAFAIILLNTDMY
SPNVKPERKMKLEDFVKNLRGVDDGEDIPREMLVGIYERIRKRELKTNEDHVSQVQKVEK
LIVGKKPIGSLHHGLGCVLSLPHRRLVCYCRLFEVPDPNKPQKLGLHQREIFLFNDLLVV
TKIFQKKKNSVTYSFRQSFSLYGMQVLLFENQYYPNGIRLTSAIPGADTKVLINFNAPNP
QDRKKFTDDLRESIAEVQEMEKYRIESELEKQKGLVRPSMSQSSGLKKDTGNGNLSRTSL
DDSYAIGEGLKRSALSSSLRDLSEAGKRGRRSSAGSLDSNMELQPFTAFLLPPSQLSP
Download sequence
Identical sequences H3CPL4
ENSTNIP00000002383 99883.ENSTNIP00000010197 ENSTNIP00000010197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]