SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002395 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002395
Domain Number 1 Region: 148-317
Classification Level Classification E-value
Superfamily E set domains 5.13e-47
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000336
Further Details:      
 
Domain Number 2 Region: 41-168
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.45e-21
Family Voltage-gated potassium channels 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002395   Gene: ENSTNIG00000010319   Transcript: ENSTNIT00000003824
Sequence length 342
Comment pep:novel chromosome:TETRAODON8:Un_random:18881029:18882193:-1 gene:ENSTNIG00000010319 transcript:ENSTNIT00000003824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRFVSKCFRDCLAERRHRRTRLVTKDGRCNIEYGNIKYSNHFALLADFWTTFVEIRWRF
VLFLFIAAFTLSWFLFGLLWYWIARTNGDLAWQNPPSNHTPCVDNVVGLTTAFLYSIETQ
TTIGYGGRALTHLCPGAVSLLVIQSLIGAIINCFMCGVILSKISLPTQNPDDGSQIYGKL
LRTTNTPDGETIIMDQVNIEFMVDAGKDNLFFVCPLTLYHVIDKSSPFFDMAVDTLHKQE
FELVVFLDGTAESTSSSCQVRTSFIPQEIMWGYNFLPIISRSKEGRYRVDFSNFSKVVPV
ATAHCAYCFHNIKGHHHHSRDGHDNKGFEVIEIQDPPSVTKM
Download sequence
Identical sequences H3CY88
ENSTNIP00000013223 99883.ENSTNIP00000013223 ENSTNIP00000002395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]