SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002401 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002401
Domain Number 1 Region: 25-156
Classification Level Classification E-value
Superfamily C-type lectin-like 1.15e-32
Family C-type lectin domain 0.00000807
Further Details:      
 
Domain Number 2 Region: 4-31
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.00000000785
Family Triple coiled coil domain of C-type lectins 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002401   Gene: ENSTNIG00000000014   Transcript: ENSTNIT00000002902
Sequence length 158
Comment pep:novel chromosome:TETRAODON8:21_random:3128190:3129363:1 gene:ENSTNIG00000000014 transcript:ENSTNIT00000002902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQMQKQINDIVQELNLLKEQQALQAVCLKGMKIHRKCYLVDPVRKSYHAASEDCSNLGG
VLGTPTSSNENDQLRDYLRQSVNPGEQVWLGVSDMVKEGAWVDITSTNITYKNWDTSNGQ
PDGGRSQNCAVLSGASNGKWLDENCKEEKPSVCQFNIV
Download sequence
Identical sequences H3C2D3
ENSTNIP00000002401 ENSTNIP00000002401 99883.ENSTNIP00000002401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]