SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002418 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002418
Domain Number 1 Region: 87-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000115
Family EGF-type module 0.013
Further Details:      
 
Domain Number 2 Region: 140-222
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000956
Family Fibronectin type III 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002418   Gene: ENSTNIG00000000597   Transcript: ENSTNIT00000002013
Sequence length 240
Comment pep:novel chromosome:TETRAODON8:7:2293885:2296172:1 gene:ENSTNIG00000000597 transcript:ENSTNIT00000002013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NRFNATVIVKTDYDELVSQDGGLLNHTRLLHAMVTGALRQNVSIRYMDSWPVDPYRTATA
LLLSCPFDLHNVTSKLLLLLKHIEEVSSVTVEDIDECKLPTLHHCLPSAECHNSLGSYRC
ICHQGYVDADPSDPGADCRAPAVISSLWSANVTGTSFCVYWSSRAQTSQVYRVVVEKGAE
TLHVWETPENTMAVPGLGPGVLYTVTVTPRGCGQPVHVAVRTGTLMNSTKYTVDGTNMTG
Download sequence
Identical sequences H3C2F0
ENSTNIP00000002418 ENSTNIP00000002418 99883.ENSTNIP00000002418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]