SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002469 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002469
Domain Number 1 Region: 1-40
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000155
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 2 Region: 212-248
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000446
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 3 Region: 47-83
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000875
Family EGF-type module 0.022
Further Details:      
 
Domain Number 4 Region: 168-217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000996
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000002469
Domain Number - Region: 124-155
Classification Level Classification E-value
Superfamily EGF/Laminin 0.036
Family EGF-type module 0.036
Further Details:      
 
Domain Number - Region: 79-99
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0818
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002469   Gene: ENSTNIG00000000773   Transcript: ENSTNIT00000000539
Sequence length 249
Comment pep:novel chromosome:TETRAODON8:Un_random:70730201:70733064:1 gene:ENSTNIG00000000773 transcript:ENSTNIT00000000539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSSNPCRNGGTCLNLLNSYHCLCPSNWEGPDCATDVNECQLFSGKAQGCQNGATCVNGPG
SFTCTCSPEWSGSLCTVRYDDCRNAAQDLCVHGTCIDADRVTPGQVAHRFPTGFSCEQLD
PPAATCSSNPGSSPSNIFEGSNIPICTCPEGYIGNGYGPSGCTQTSNICQTSSPCVHGQC
VVSVDLHLAFSSAPGYICICNSGWQGVNCEQNINECASSPCLNGGTCSDGVNGFTCSCTA
QWTGPLCQT
Download sequence
Identical sequences H3BWA3
ENSTNIP00000002469 99883.ENSTNIP00000000265 ENSTNIP00000000265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]