SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002599 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002599
Domain Number 1 Region: 7-175
Classification Level Classification E-value
Superfamily E set domains 6.3e-76
Family Arrestin/Vps26-like 0.000000289
Further Details:      
 
Domain Number 2 Region: 181-330
Classification Level Classification E-value
Superfamily E set domains 1.35e-28
Family Arrestin/Vps26-like 0.00000351
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002599   Gene: ENSTNIG00000004064   Transcript: ENSTNIT00000001211
Sequence length 334
Comment pep:novel chromosome:TETRAODON8:Un_random:25563190:25571837:1 gene:ENSTNIG00000004064 transcript:ENSTNIT00000001211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESKTGTRVFKKTSPNSKLTVYLGRRDFVDHVSCVDPVDGIVLVEPEYLKDRKVFVTLNC
AFRYGQEDLDVLGLSFRKDLFAKTIEVFPPAEKDQKPANLQNRLLTKLGQNAYPFTFTIP
QNLPCSVTLQPGPQDSGKACGVDYELQAFCAKSADEKIHHRNSVHLVIRKVQFAPETPGP
QPIETHRSYLMSDRSLHLEASLDKEVTHTWVFCKLQRNKNTHNAQLQIKHKVPVRQYADI
CLFSMAQYKCQVAHLEADDQISPSSTSCHIYTLTPLLRNNREKRGLALDGKLKHEDTNLA
SSTIIKEGASKEMMGILVSYRVKVKLVVSLGGYV
Download sequence
Identical sequences H3C2Y1
ENSTNIP00000002599 99883.ENSTNIP00000002599 ENSTNIP00000002599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]