SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002611 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002611
Domain Number 1 Region: 241-416
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.96e-43
Family MAM domain 0.00056
Further Details:      
 
Domain Number 2 Region: 31-126
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000326
Family I set domains 0.037
Further Details:      
 
Domain Number 3 Region: 83-225
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000155
Family Fibronectin type III 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002611   Gene: ENSTNIG00000010979   Transcript: ENSTNIT00000002047
Sequence length 450
Comment pep:novel chromosome:TETRAODON8:14:7213609:7220787:1 gene:ENSTNIG00000010979 transcript:ENSTNIT00000002047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SREMTGSYRCQTSQYNGFNVKPREAVVELIVQYPPTVEPVFMEMRQGLGRPVVMTCRVLR
AHPSRVLRFEWLLSNRLLHAGAFDAQRDETEYTVRNLNRDGLGEYTCNVINEAGAGKCTF
LVTGKAYPPEFYYDTYNPVWQNKPRIYNFKLQWTQMNPNAVDRIVAYRLGFRQMGLQRWW
EQEIPVDGPINKGELMSHNLTELVRPESYEVRLTPITRFGEGDSTIRIVRYSAPINPHLR
EFHCSFEEEPICMFTQDKNDDFDWTRHSAATRDTKYTPNTGPSVDRTGSKQGFYMYIETS
RPRKEGDQARLVSPFFDVAPKNPYSISNPPAYCFGFFYHMYGKHIGTLNAFLKQKGQTSS
EGPVWSLIGNQGDHWRQAKVSIHPTSSFQVVLEGIRGPGIEGDIAIDDVTLEEGECRDPP
TNLSSKDLLGSSHIWLLCVTLVMTFLEGQR
Download sequence
Identical sequences H3D073
99883.ENSTNIP00000013909 ENSTNIP00000013909 ENSTNIP00000002611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]