SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002651 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002651
Domain Number 1 Region: 239-278
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000000353
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 2 Region: 80-119
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000249
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 3 Region: 2-38
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000157
Family LDL receptor-like module 0.00055
Further Details:      
 
Domain Number 4 Region: 156-197
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000432
Family LDL receptor-like module 0.00075
Further Details:      
 
Domain Number 5 Region: 195-236
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.00088
Further Details:      
 
Domain Number 6 Region: 41-77
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000654
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002651   Gene: ENSTNIG00000001606   Transcript: ENSTNIT00000003640
Sequence length 280
Comment pep:novel chromosome:TETRAODON8:12:2572636:2575340:1 gene:ENSTNIG00000001606 transcript:ENSTNIT00000003640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPACQNDEFQCKRGGCIPVMWRCDGDNDCADNSDEEGCGRTCWGRKKKTPNTRNCIRAMW
RCDGENDCGDNSDEEGCGKMCPAPQFQCNDSVCIPAGWRCDGSKDCPDNSDEHNCPCEWA
TGLGSWRAAILPVCLMGRKAGDPGDSHRCPARVRSACCNHVCETEEFRCSGGDCIPALWR
CDGDSDCPDGGDEANCPRRECAPKTFQCENGDCVLAGWRCDGDSDCSDRSDEDNCTRTWP
RATCPPGHFRCKNGECIPARWRCDDDFDCSDGSDEENCCK
Download sequence
Identical sequences H3C333
ENSTNIP00000002651 ENSTNIP00000002651 99883.ENSTNIP00000002651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]