SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002763 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002763
Domain Number 1 Region: 19-155
Classification Level Classification E-value
Superfamily C-type lectin-like 6.87e-40
Family C-type lectin domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002763   Gene: ENSTNIG00000000737   Transcript: ENSTNIT00000001734
Sequence length 169
Comment pep:novel chromosome:TETRAODON8:4:6792811:6794068:1 gene:ENSTNIG00000000737 transcript:ENSTNIT00000001734 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMKRSSEEVGVFCHRMNPFHQCQADCQCQPGWREYEDRCYLFSSDLKTWLEANAYCLEQ
NSNLMSIQDVHERLWVRTQIGAEIFWIGLNDRVTEGVWEWSDGTPYVEYLSFWMLGQPDD
WGEEPGEDCGQVVGYNNGHWNDDNCNNKRKYICKHINRKCGIGAPRPPP
Download sequence
Identical sequences H3C3E4
ENSTNIP00000002763 99883.ENSTNIP00000002763 ENSTNIP00000002763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]