SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002958 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002958
Domain Number 1 Region: 95-238
Classification Level Classification E-value
Superfamily C-type lectin-like 7.04e-39
Family C-type lectin domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002958   Gene: ENSTNIG00000000419   Transcript: ENSTNIT00000001605
Sequence length 242
Comment pep:novel chromosome:TETRAODON8:Un_random:54063283:54068061:1 gene:ENSTNIG00000000419 transcript:ENSTNIT00000001605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPALTAAVILVLVIALGASNAGTSSRLWVLETSVLNLTESQRSTQQLSKAAANDVRLLK
FAVGSNSDKLSSVAEPLKELTILKSLSRTPSHLKCSLERIINNGSVSGSCCPLDWDSFGQ
SCYFFSKTLLSWEEARDWCEGHESHLVILTNDKQWDFVVRLAAGALYWVGLTDETGKWEW
VNGTPYVMERRRWRPGQPDSWTGHGLGWGDEDCAHMHEDGRLNDLHCTTRLRFICQKHSQ
RA
Download sequence
Identical sequences H3C3Y9
ENSTNIP00000002958 99883.ENSTNIP00000002958 ENSTNIP00000002958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]