SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003040 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003040
Domain Number 1 Region: 119-312
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.49e-25
Family Laminin G-like module 0.024
Further Details:      
 
Domain Number 2 Region: 60-96
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000147
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 331-374
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000156
Family EGF-type module 0.019
Further Details:      
 
Domain Number 4 Region: 378-409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000133
Family Laminin-type module 0.083
Further Details:      
 
Domain Number 5 Region: 5-58
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000019
Family Laminin G-like module 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003040   Gene: ENSTNIG00000001031   Transcript: ENSTNIT00000003568
Sequence length 411
Comment pep:novel chromosome:TETRAODON8:17:4288740:4303406:1 gene:ENSTNIG00000001031 transcript:ENSTNIT00000003568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGAFGPIFLGAVSSHWETPDRTGERLRRFIGCMGKLRVNSIDRDLIGEAVRGRNIENCDP
PACQHLPCRNGGTCVSDAENWFCQCRPLYTGRLCQFSACERNPCSHGATCIPKSPLEAVC
LCPYGRQGLLCEEPINITRARFSGGGAQFGYTSFAAHSDLPSFTFFYEFRLQITLANNSM
AARDNLVLFAGHKGQGNNGDDYLVLGLRSGRVVHRFNLGSGVATIVSDRLDPRVTIHSVV
FGRSGKTGWLKVDGQRNQTRSSPGLRGLKDFKHLFVGGYREYTPELLPLGSRFSQGFQGC
IFDVKFSTRRGGTFQALGHPSFGRNVGQCGVNPCDHVHCGHGGTCVDSGSSVYCQCPLGW
KGALCTETVSVCDVEHSPPPLCAQGSTCIPLPNGYTCRCPLGTAGMYCDKG
Download sequence
Identical sequences H3C471
ENSTNIP00000003040 ENSTNIP00000003040 99883.ENSTNIP00000003040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]