SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003112 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003112
Domain Number 1 Region: 422-681
Classification Level Classification E-value
Superfamily YWTD domain 5.1e-49
Family YWTD domain 0.0000000847
Further Details:      
 
Domain Number 2 Region: 249-292
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000017
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 3 Region: 128-168
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000576
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 4 Region: 214-254
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000641
Family LDL receptor-like module 0.00058
Further Details:      
 
Domain Number 5 Region: 10-48
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000017
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 6 Region: 167-207
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000131
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 7 Region: 50-88
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.00088
Further Details:      
 
Domain Number 8 Region: 376-416
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000401
Family EGF-type module 0.0013
Further Details:      
 
Domain Number 9 Region: 87-129
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000877
Family LDL receptor-like module 0.00057
Further Details:      
 
Domain Number 10 Region: 297-333
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000877
Family LDL receptor-like module 0.00037
Further Details:      
 
Domain Number 11 Region: 340-382
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000703
Family EGF-type module 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000003112
Domain Number - Region: 684-726
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000112
Family EGF-type module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003112   Gene: ENSTNIG00000010322   Transcript: ENSTNIT00000003724
Sequence length 827
Comment pep:novel chromosome:TETRAODON8:Un_random:23487171:23516785:1 gene:ENSTNIG00000010322 transcript:ENSTNIT00000003724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HCASVFVGTKTECEASQFQCGNGRCILSVWQCDGDDDCTDGSDENSCVQKTCAESDFVCQ
NGQCVPKRWHCDGEPDCEDGSDESLDICHTRTCRLNEVSCGAGSSNCISVFWKCDGEKDC
DNGEDEVNCGNITCAPNEFTCASGRCISRNFVCNGEDDCGDGSDEVACAPSSCAPSEFQC
GNSSCIPASWVCDDDVDCQDQSDESPSRCGRHPTPPAKCSSSEMQCRSGECIHKKWRCDG
DRDCKDGTDEANCPVRTCGLDQFRCDDGTCIPGSKQCNGLRECPDGSDELNCKNVTQCSG
PDKFKCRSGECIEMSKVCNKVRDCPDWSDEPIKECNFNECLLNNGGCSHICKDMVIGFEC
DCTPGLQLIDHKTCGDINECLNPGICSQICINLKGGYKCECHNGYQMDPTTGVCKAVGKE
PCLIFTNRRDIRRLGLERKEYTQLVEQQRNAVALDADFNQQMIFWADLGQKAIFSAMLDK
RGEIGAHKLIDHVQTPVGIAVDWVYQNLYWSDLGPKTISVSNFNGTKAKVLFDRSLKEPA
SIAVDPLSGVLYWSDWGEPAKIEKSGMNGVDRQVLVASDIQRPNGITLDLIKGRLYWVDS
KLHMLCSVDLNGDNRKKVLQSSEYLAHPLALTVFEDRVFWTDSDNQAIYGANKFSGSDVT
TLASNLNNPQDLIVYHELIQLSGTNWCAENGENGGCSYMCLPAPQINKHSPKYTCVCPDG
QELAAERLTLHSREANVSTSIQVDSTARGSAAAWAILPVLLLAMAAAGGYLMWRNWQLKN
QKSMNFDNPVYLKTTEEDLNIDITRHGANVGHTYPAISIVSTDDDLS
Download sequence
Identical sequences H3C4E3
ENSTNIP00000003112 ENSTNIP00000003112 99883.ENSTNIP00000003112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]