SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003135 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003135
Domain Number 1 Region: 260-317
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000183
Family TSP-1 type 1 repeat 0.00051
Further Details:      
 
Domain Number 2 Region: 316-374
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000034
Family TSP-1 type 1 repeat 0.00038
Further Details:      
 
Domain Number 3 Region: 63-121
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000144
Family TSP-1 type 1 repeat 0.00062
Further Details:      
 
Domain Number 4 Region: 542-591
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000549
Family TSP-1 type 1 repeat 0.00048
Further Details:      
 
Domain Number 5 Region: 472-517
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000183
Family TSP-1 type 1 repeat 0.0009
Further Details:      
 
Domain Number 6 Region: 127-167
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000471
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 
Domain Number 7 Region: 171-225
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000441
Family ATI-like 0.075
Further Details:      
 
Domain Number 8 Region: 20-83
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000146
Family VWC domain 0.088
Further Details:      
 
Domain Number 9 Region: 383-433
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000441
Family BSTI 0.057
Further Details:      
 
Domain Number 10 Region: 599-655
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000018
Family ATI-like 0.075
Further Details:      
 
Domain Number 11 Region: 3-29
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000589
Family ATI-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003135   Gene: ENSTNIG00000000924   Transcript: ENSTNIT00000000892
Sequence length 659
Comment pep:novel chromosome:TETRAODON8:Un_random:91364441:91366867:1 gene:ENSTNIG00000000924 transcript:ENSTNIT00000000892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATSCYDGCYCAPGFYLLNRSCVPLSQCPCYHQGQVYDANTTLPNDACNNCTCINGDMECG
SSPCPVDCGWSSWTQWSACSRTCDVGVRRRYRSGTNPPAAFGGQPCKGDRVGIDTCSIEP
CFGTKEPWTPWSECSVTCGGGYRSRTRGPIRVHGTAQQFSACNLQPCGNRTACPPGQQWE
DCVRGAVSCSDVTMELYRNCTPGCQCPHGTLLRDGVCVQESDCRCDVNRQQHKPGDAVLI
DCRTCECEAGKLVNCSQANCNVDGQWSVWTPWGDCSVTCGVGLQSRYRFCPSLQPSESGL
SCLGPHREDQVCLSAPCDRDGGWGQWSNWTACTKSCGGGIQTRKRDCDNPIPEQEGRFCE
GLGTEVLSCNTNHCPVAPCSLVPGTVFSSCGPSCPRSCEDLAFCEWQCEPGCYCTEGKVL
SANGTVCVDREECPCLDLSTGYMLKPGETTKAPDGCNNCTCERGRLNCSSHPCPVLGGWC
EWSEWTPCSRTCGAESVTRYRSCSCPEPKAGGASCSGVQELHNGIGVQILQQPCPVIVFC
PVHGSWSHWSDWSECDACTGLSTRTRECNSPPSRFGGLPCLGERRQSRGCHDNFTVCSDC
GGGKEEWPCGKPCPRSCSDFHGDTECLDSPGCQMTCGCPGDLVLQDGACVAREDCRCKY
Download sequence
Identical sequences H3BZ44
ENSTNIP00000003135 ENSTNIP00000001260 99883.ENSTNIP00000001260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]