SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003188 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003188
Domain Number 1 Region: 435-703
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.08e-74
Family Eukaryotic proteases 0.0000691
Further Details:      
 
Domain Number 2 Region: 27-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-31
Family Spermadhesin, CUB domain 0.0000681
Further Details:      
 
Domain Number 3 Region: 190-305
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.26e-22
Family Spermadhesin, CUB domain 0.00039
Further Details:      
 
Domain Number 4 Region: 309-379
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000025
Family Complement control module/SCR domain 0.00075
Further Details:      
 
Domain Number 5 Region: 376-446
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000375
Family Complement control module/SCR domain 0.00096
Further Details:      
 
Domain Number 6 Region: 137-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000297
Family EGF-type module 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003188   Gene: ENSTNIG00000008036   Transcript: ENSTNIT00000001285
Sequence length 704
Comment pep:novel chromosome:TETRAODON8:8:9135305:9138768:-1 gene:ENSTNIG00000008036 transcript:ENSTNIT00000001285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NSLFTNLSSFLYVTVSLCWPLLEVEPEMYGEVKSPQYPKPYAPNLLEQWDLSVPEGFQIR
ITFTHLDIDASPGCHYDALTVYNGKKVLGKFCGSENSADGHHPGTEPLLSPGNTLTLVFK
SDSTNPERHQNVGFSAHYQAIDMDECAAEEPEDGSEPLCSQICLNTLGSYVCSCHHGFKL
QSDQRSCALSCNGGLFDEPKGHLASPGYPSLEQQALTCRYVISVPDGFTVSLNFSDSFHI
ESIDTKQGPECLHHWLQVSVPDQQPYKLCGDRSPGVIVTSSSSVTLDYHTDADGWSRGWS
LDYSTHRVQCPSPGSVAHARVTPTLNQYLYRDHIFVRCDTGYKLMMDGEELRSFSAMCQS
NGQWHLPLPECHIIDCGEPERLLNGGFEFVSGYQNQYQSVIKYHCNQPFYAPLGENEVSF
TCDADRSWRSINDLIVPPLCLPVCGQSLNPVSGHQRIIGGNVAQANSIPWQVLLSISGNR
AGGMVIADRWILTAAHVLTSGGSTVLANSVRIYMGLNTVEDPLPSHVNPTSIHIHPEYNN
PNLMDFNNDIALIKLQDPVTFSESVMPVCLPGDGSALVTGDIGVVSGFGITNEQKRRILT
NRLKYVSLPVVDQGKCNASVIEEKNKKPDTPSLTDNMFCAGLPEGGKDSCQGDSGSPFTI
SHDNRAWAAGIVSWGIECGRQGVYGVYTSVTKYLDWINKTMQEN
Download sequence
Identical sequences H3CRH4
ENSTNIP00000003188 99883.ENSTNIP00000010858 ENSTNIP00000010858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]