SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003233 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003233
Domain Number 1 Region: 186-396
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.2e-55
Family Reprolysin-like 0.0011
Further Details:      
 
Domain Number 2 Region: 485-540
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000772
Family TSP-1 type 1 repeat 0.00052
Further Details:      
 
Domain Number 3 Region: 864-925
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000131
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 4 Region: 817-867
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000157
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003233   Gene: ENSTNIG00000011753   Transcript: ENSTNIT00000003233
Sequence length 925
Comment pep:novel chromosome:TETRAODON8:7:5558002:5566668:1 gene:ENSTNIG00000011753 transcript:ENSTNIT00000003233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METELCYPVEMDDRNQDRKDFQNDVENLHGKHVLKIRAFQQELVLDLHQDFSFIAPSVAN
QDKFWSPDGDDTADLSRCFYSGYVNSDRESYAALSLCKGLRGAFGFQGWEYFISPVQNRS
TESAHIIRRRTNSNQKLNSTSRCAVDSDLSLKAAKSLAKYKHLEDGSNVTETVLRKIGRA
KRFASVPRYVETLVVADSSMVQFHGSDLKHYLLTLMSVAARLYKHPSILNFINIAVVKIV
IISEEDKGPKVSGNAAMTLRNFCTWQKKLNKNTDKHPEYWDTAILFTRQDLCGASTCDTL
GMADVGTMCDSKRSCSVIEDDGLPSAFTTAHELGHVFNMPHDNVKACADVFGKLQDNHMM
SPTLIQINRTSPWSPCSAAIITEFLDSGHGECLLDQPQKPLVLPDVQPGASYGIDRQCEL
AFGEGSKPCPFIQPPCGRLWCTGKSNGHLVCMTRHFPWADGTQCGNDQVCEQGICSDRQL
QNAKVDGRWGKWGQFGSCSRTCGGGVQLSRRECNNPVPSNGGKYCQGVRVKYRSCNLNHC
PDKGRTFREEQCERSGLNFSNNRIAPFMVWVPKYSGVSSDDRCKLICRANGTGYFYVLAS
KVQLWDGTPCSPDSTGVCVQGKCIKAGCDGKIGSDKKFDKCGICGGDNKGCKKVSGLFTK
PVHGYNFVVMLPVGAANIDIRQRGYKGMTSDDNYLAVKNSDGRYLLNGNYIVSAGERDII
VKKSLLRYSGTTGLSETLQSVKPLEEALTVEVLCAGQITPPRIRYSFYLSRQNKEDKNLK
KEAHDNSPNSVLAHDGAKENGAKLLKKSYNKENPAPGKWISAVWDKCSVTCGNGLQRRSV
QCLKPDGKPATDCDSSQQPSDTRVCGTPCPEWLIGQWSPCSRTCGKGFKRRPLHCKTQSG
HSLPRDRCTGLQKPQELDFCNLRSC
Download sequence
Identical sequences H3D2G7
ENSTNIP00000003233 ENSTNIP00000014705 99883.ENSTNIP00000014705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]