SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003389 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003389
Domain Number 1 Region: 458-652
Classification Level Classification E-value
Superfamily Sec7 domain 5.76e-64
Family Sec7 domain 0.00000656
Further Details:      
 
Domain Number 2 Region: 671-799
Classification Level Classification E-value
Superfamily PH domain-like 1.76e-16
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003389   Gene: ENSTNIG00000014953   Transcript: ENSTNIT00000004023
Sequence length 893
Comment pep:novel chromosome:TETRAODON8:Un_random:28112114:28114749:1 gene:ENSTNIG00000014953 transcript:ENSTNIT00000004023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRSRHQPASLALRKQEEEESKRCKALSDSYELSTDLQDKKVEMLERKYGGPFVSRRAART
IQTAFRQYRMNKNFERLRSSASESRMTRRIILSNMRMQVHTLAFPRQLYTVALSWTCTRL
TSARRFASFQQPSRAPVKISGRSFIKRRRHETRVLQVKSLADSMDDSLTCQSGREDSQEV
GAGRVGGAGGRGGMGGGAAMHEDSTATSFSDVTLYMEEGCLPSSPLSRPPSSPLSRPASS
SDTEYWGGGGGAGGGAGGREDSRETEGGSIGSRRSSTPCTECQGEYRGRSSGGGGGGGHL
PVLTIEPPSDSSVDMSDRSERGSIGRLVYEQEPEADSPQGTIKHKPNGREPPSSPLPSTG
STRHAPLPTATAVTPSPLSSSSSMLHNICSDGDNESVNSTTTNSNDDTTVNNCSSGSSSR
DSLREPLGGATPGKQTYQRESRHSWDSPAFNNDVVQRRQYRIGLNLFNKKPEKGIQYLIE
RGFVSDTPVGIARFILERKGLSRQMIGEFLGSRQQFNKDVLTCVLDEMDFSGMDLDDALR
KFQAQIKVQGEAQRVERLVEAFSQRYCVCNPVLIRQFQNPDTIFILAFAIILLNTDMYSP
NIKPERKMKLEDFIKNLRGVDNGQDIPRDLLVAIYGRIQKWELRTNDDHVSQVQAVERMV
VGKKPVRHLSEGGQVLSMPHRRLVCCCQLFEVPDPNRGQRSGVHQREVFLFNDLLMVTKI
FQKKKTSVTYSFRQSFPLLDMQVHTFQNTYYPHGIRLTSANPGGESKVLIVFTAPSQQDR
ARFTSDLRESVAEVQDMEKYRVESELEKQKGVMRPSVFTAGPLKNEVLNGTLGRPSLDDT
YASVDGLKRTALSSSLRDLSETGKRGRRNSVGSLDSTIELEGEEPTDPSIQCT
Download sequence
Identical sequences H3DBV8
ENSTNIP00000018001 99883.ENSTNIP00000018001 ENSTNIP00000003389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]