SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003441 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003441
Domain Number 1 Region: 2-53,177-237
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000773
Family Calmodulin-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003441   Gene: ENSTNIG00000001442   Transcript: ENSTNIT00000003393
Sequence length 241
Comment pep:novel chromosome:TETRAODON8:Un_random:29555138:29556831:1 gene:ENSTNIG00000001442 transcript:ENSTNIT00000003393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEGKGSIDLEDLQTVCRQFQLPVGGSVLEDLMDYCDADRDGLISFVEFANFLSWKDMMPI
SREEEHLLTRGRTSERHSVRRQRGNTASSFCGGPARQALVRPEDLEPINPAGSLKSVRTL
VKQQAEPDQRHQPSLFASSSGPGPAPSTDRHTCGVPSVVRRAGDTATAAGLLHPSVYHLH
GVDEEQLLRPRSRKELSQIFRNVGVDLSEETFEKVWALAAAAHQAGEVCVETFRRALKET
Q
Download sequence
Identical sequences H3C5C2
ENSTNIP00000003441 99883.ENSTNIP00000003441 ENSTNIP00000003441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]