SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003507 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003507
Domain Number 1 Region: 141-177,277-528
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.15e-83
Family Eukaryotic proteases 0.0000525
Further Details:      
 
Domain Number 2 Region: 44-106
Classification Level Classification E-value
Superfamily GLA-domain 6.48e-23
Family GLA-domain 0.00038
Further Details:      
 
Domain Number 3 Region: 96-128
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000107
Family EGF-type module 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003507   Gene: ENSTNIG00000006321   Transcript: ENSTNIT00000000875
Sequence length 532
Comment pep:novel chromosome:TETRAODON8:7:10294499:10297100:1 gene:ENSTNIG00000006321 transcript:ENSTNIT00000000875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARVGLLALAAAFLLEASGQKTTAGVFVSQQAANAVLLRRRRYNSGHLEEFQKDNLEREC
KEEQCTMEEAREVFEDDEKTAEFWVGYIDGDQCVPPPCQNEGVCKDGVNSYVCWCKPDFS
GRNCEIEVSKQCSVKNGGCSHFCVMEGDVSVCHCAVGYQLGPDRRSCEPTGQFSCGRVHI
SSSQSSLRRRSLSQQPEANGTLGGPLLGGPLLGGPSDTVTDPSDYDDYLSENVSEPLDSP
GIDVRSVKTSSVDEDGRNLTEGQIPYWASPTLPTIREQKNTDQRIVGGDEAIPGEIPWQV
TLMSHSVVLQTAEPFCGGSLLSDWWVITAAHCLMNENIAKRGFFVRLGEHDVSKPEGPER
DYQVAEQHVHFMYDYKKSPYNHDIALLKLAQPVELSHQRRPICLGPKDFTETLLRESTTS
MVSGWGRIKFRGLEATKLQKLEVPYVDRTRCKQSSREQVTRFMFCAGYQDMGKDACQGDS
GGPHATKFKDTWFLTGIVSWGEECAKDGRYGVYTRVSRYYPWISQKTGLQMS
Download sequence
Identical sequences H3C5I8
ENSTNIP00000003507 99883.ENSTNIP00000003507 ENSTNIP00000003507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]