SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003710 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003710
Domain Number 1 Region: 25-147
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000412
Family V set domains (antibody variable domain-like) 0.025
Further Details:      
 
Domain Number 2 Region: 138-191
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000278
Family I set domains 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003710   Gene: ENSTNIG00000000565   Transcript: ENSTNIT00000000675
Sequence length 199
Comment pep:novel chromosome:TETRAODON8:7:4521083:4522506:1 gene:ENSTNIG00000000565 transcript:ENSTNIT00000000675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSSGGWMLCSLCVCFGALESDSLRVTMREPRLKVVQGDFVVLPCSFFTSSPLSRLNIIW
TMAPSSSPESPIQVIVYDHGQVIEDSALIGRVGFTGIPWSADIVLNDTRVSDAGTYRCMV
NNPPEAPDPGIGELELSVVAPPSLPVCQWEGDVTAGGSVTLSCSVAEGTPTPEIRWTKVN
PQEVELPINMDGQFWVYFE
Download sequence
Identical sequences H3C640
ENSTNIP00000003710 ENSTNIP00000003710 99883.ENSTNIP00000003710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]