SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003716 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003716
Domain Number 1 Region: 1-20,51-67
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.00000288
Family Thyroglobulin type-1 domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003716   Gene: ENSTNIG00000000797   Transcript: ENSTNIT00000000432
Sequence length 132
Comment pep:novel chromosome:TETRAODON8:Un_random:36718533:36719287:1 gene:ENSTNIG00000000797 transcript:ENSTNIT00000000432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CDESGTFLPVQCVFINTTTGTHLDLMSIFSSFPEAFETFAGFRKLFPTVSSYCFCSDSRG
REMHNTGVELLLSDVYDSAFVAHPPIHTFAQSNIYQVLQRRMLAVRLAVTGHFRCPSSCE
EEQRSAKEALNV
Download sequence
Identical sequences H3CJT4
ENSTNIP00000003716 ENSTNIP00000008513 99883.ENSTNIP00000003716 99883.ENSTNIP00000008513 ENSTNIP00000003716 ENSTNIP00000008513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]