SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003724 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003724
Domain Number 1 Region: 1-144
Classification Level Classification E-value
Superfamily C-type lectin-like 2.58e-37
Family C-type lectin domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003724   Gene: ENSTNIG00000000304   Transcript: ENSTNIT00000004170
Sequence length 146
Comment pep:novel chromosome:TETRAODON8:Un_random:12785183:12786180:1 gene:ENSTNIG00000000304 transcript:ENSTNIT00000004170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPKCRDGWEEFEGQCYYFSNNTSKWEEARERCQLQGADLVQVSSRKEQEFLTDRVKQMMR
GNNDLFWIGLTDSVTESTWLWVDGSPLEQGFVLTFWHNREPNNWDDEDPVRGEDCVRLGD
INGNINCWSDRACSHPERSICEKPEQ
Download sequence
Identical sequences H3C654
ENSTNIP00000003724 ENSTNIP00000003724 99883.ENSTNIP00000003724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]