SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003740 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003740
Domain Number 1 Region: 160-335
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.65e-50
Family SPRY domain 0.0000427
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003740   Gene: ENSTNIG00000008438   Transcript: ENSTNIT00000000286
Sequence length 338
Comment pep:novel chromosome:TETRAODON8:13:8296344:8298101:1 gene:ENSTNIG00000008438 transcript:ENSTNIT00000000286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EISAMLEPLKKQLRKLDKTREQWEETRTYIQTQAVENEKAIREEFDKLHSFLVEEERNRL
KVLRQEEEIKKQVMTEKLKTLTEKIESLSATISDVETTLKEKDLPFLMMLAEKHNLCPCF
RARCSLHEPECIRDILINSAKHLGSLRFGVWNKMVASVKCAPFVLDPNTAQSNLRFSEEL
TCVQYSSKRALPDNPERCTSRVCVLGATGFTSGKHSWTVDVGQGKDWYIGAAAESIKRKT
AVFLNPAEGFWVIGLCNGDTFWAQTAPRVKLALKQKPERITVKLDYDKGKVVFINAEDST
TIHTFSDKFVERIFPYFSPGLYKDGKTSSPLTLYHHVP
Download sequence
Identical sequences H3CSP0
99883.ENSTNIP00000011274 ENSTNIP00000003740 ENSTNIP00000011274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]