SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003914 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003914
Domain Number 1 Region: 1772-2028
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.97e-52
Family Ankyrin repeat 0.0000000573
Further Details:      
 
Domain Number 2 Region: 1090-1228
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.69e-16
Family Growth factor receptor domain 0.0056
Further Details:      
 
Domain Number 3 Region: 815-944
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000471
Family Growth factor receptor domain 0.0089
Further Details:      
 
Domain Number 4 Region: 399-529
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000022
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 5 Region: 712-755
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000878
Family EGF-type module 0.0038
Further Details:      
 
Domain Number 6 Region: 588-722
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000251
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 7 Region: 750-789
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000411
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 8 Region: 563-605
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000446
Family EGF-type module 0.0041
Further Details:      
 
Domain Number 9 Region: 136-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000129
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 10 Region: 246-415
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000188
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 11 Region: 214-262
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000603
Family EGF-type module 0.012
Further Details:      
 
Domain Number 12 Region: 525-563
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000138
Family EGF-type module 0.011
Further Details:      
 
Domain Number 13 Region: 942-980
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000158
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 14 Region: 176-219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000173
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 15 Region: 1471-1503
Classification Level Classification E-value
Superfamily Notch domain 0.000000157
Family Notch domain 0.0019
Further Details:      
 
Domain Number 16 Region: 1345-1392
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000406
Family EGF-type module 0.013
Further Details:      
 
Domain Number 17 Region: 1223-1264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000453
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 18 Region: 1391-1423
Classification Level Classification E-value
Superfamily Notch domain 0.000000458
Family Notch domain 0.0011
Further Details:      
 
Domain Number 19 Region: 99-144
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000628
Family EGF-type module 0.017
Further Details:      
 
Domain Number 20 Region: 1432-1465
Classification Level Classification E-value
Superfamily Notch domain 0.000000759
Family Notch domain 0.0074
Further Details:      
 
Domain Number 21 Region: 980-1021
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000877
Family EGF-type module 0.0042
Further Details:      
 
Domain Number 22 Region: 62-98
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000261
Family EGF-type module 0.011
Further Details:      
 
Domain Number 23 Region: 12-63
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000107
Family EGF-type module 0.011
Further Details:      
 
Domain Number 24 Region: 1264-1298
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000786
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000003914
Domain Number - Region: 1306-1343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000554
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 1071-1098
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0108
Family EGF-type module 0.05
Further Details:      
 
Domain Number - Region: 1018-1054
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0272
Family EGF-type module 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003914   Gene: ENSTNIG00000006640   Transcript: ENSTNIT00000000166
Sequence length 2435
Comment pep:novel chromosome:TETRAODON8:1:14178567:14191288:-1 gene:ENSTNIG00000006640 transcript:ENSTNIT00000000166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CAPGFLGEYCQHKDPCQPGYCLNGGNCSVSTSAGVPVPGSATCSCPLGYTGQHCQSPQNS
TCYPNNPCANRGVCTLLPFNKYKCECARGWTGTGCEYEDKCLSSPCANGGTCSSVSGGSF
TCSCPPGYAGARCLNDTNECAATPSICQNEGGCINTPGSYKCVCTPGFTGKHCESSYIPC
SPSPCLNGGTCHQTSETSYSCHCLPGFNGTNCENNIDDCPGNQCANGGTCIDGVNTYNCQ
CPPEWTGQHCTEDVNECRLQPNTCQNGGTCSNLLGSYVCVCVNGWSGSDCSENIDDCATA
ACSHGSTCEDRVASFVCHCPYGKTGLLCHLNDACISNPCRGGSKCDTNPITGMFNCNCPP
GYTGITCNIDRDECSIAGTNPCEHDGQCVNTEGSFTCNCAKGYTGPRCEQDVNECASNPC
QNDGTCLDRIGVYTCICMPGFEGPHCQIEINECLSSPCLNRGKCLDQVNRFVCECPAGFS
GETCQINIDECSSTPCLNGAKCIDLPNGYDCECAEGFQGQLCEENINDCVPEPCHHGKCK
DGIATFSCECQPGYTGAICNVQVQECHSNPCQNRGRCIDLVNAYQCNCPPGITGVNCEIN
EDDCASNLCEFGECQDGINEYKCVCSPGYTGDKCDVEINECSSNPCKSGGTCVDKVNGFH
CLCPPSTHGLLCLSGTDQCANQPCIHGQCIEQQYSYFCQCEAGWMGQHCEQEKNECLPNP
CLNGGSCLDRHNGYTCTCQLGFSGVNCEKNINECASEPCLNQGTCVDGLNSYTCLCSPPF
TGTCCTIYMATNMIIICQRGGVCLPSNDYTSYTCRCPAGWQGEQCSEDVNECKKNPCRNG
GHCMNSPGSYTCKCPLGYSGHNCQTDIDDCSPNPCLNGGSCVDDVGSFSCKCRPGFEGEH
CEEEVDECASQPCSNGAICRDYVNSFVCECQPGFDGILCNHNILECTESSCLNNGTCIDD
INTFFCRCRPGFFGTFCENEQNECESQPCINGGTCTDGLGTYRTCPARYSGQNCQNYVNL
CRQVRCHNGGSCSHTGPTTWTCHCQTWTGLYCDVPNMSCQDFAARKGLEVENVCKNAGRC
VNVENFHKCECQPGYTGSYCEEMIDECKSNPCRNGATCKDYQSTYECLCKPGYQGVNCEY
EVDECHSKPCLHGGTCINLINKFTCICPPGTHGVQCEVNVDDCAPNSGSWEPRCLNGGQC
VDGIGRYTCSCPPGFVGEHCEGDLNECLSGPCHSPGSLDCVQLVNDYQCRCRLGYTGRHC
DSMVDLCLSKPCRNGGVCTMNTTSVHGFMCSCSPSFMNLTAPGLSKHNCLYLDARNGGRC
VESTAGQLYCQCQQGFSGAHCENSQRCMLPCKNGGTCVRDSANPFQYSCHCPINFSGRYC
EINVLRTGPSTCPYIQCKQQSGDTVCDDQCNNYECQWDGGDCSLNWKQPWMNCTAGVACW
DFFKNGRCDKECDTAGCLFDGFECQESSACNFRYEKYCADHYGNGICDGSCNTEACGWDG
LDCASNTPAKIVPGTLVIVVQLQPKELLVDLTGFIRFLGALLHTNLQVKVDENKKPMVYP
YFGAEEDHGHQARRSRSKREVEKEVIGSFVYLEIDNRKCSESPGECFSNIDEAASFIAAA
RIKDGLPYPLVSVNSRYMDPPPPTNYVPYLVGVSVVIILLILVLGMLAAKRKHKHGVLWL
PDGFMTNKNDKRREPVGQDDFDLKNFKTQDGGVMDSGQSQRWLEDEVPSRKPRLEGKPLL
PLPMDGAIDRREWTLQHRKAADISLTPPQAELDSDGLDVNVKGPDGFPLMLASLRNGGVP
DCNLHGDEEEESGGDEPGSSVISDLISQGASLIAQTDRTGETALHLAARYARADAAKRLL
DAGADPNAHDNMGRTPLHAAVAADAQGVFQILIRNRATELDSRMNDGTTPLILAARLAVE
GMVEELIHCHADINAVDDHGKSALHWAAAVNNVEATLVLLKNGANRDMQDNKEETPLFLA
AREGSFEAAQVLLDHYSNRDITDHMDRLPRDTAQERMHHDIVRLLDQYNVVHSPHNPNLM
GGGNPSMMCGANGAGFMAVRPGPQGKKSRRGGGGAKVGGVGGGAKELKDMKSKRRKKPRG
VEGPGVSAAAGGASGGGSANGVKTAGALPESSVTMSPVDSLESPHSYLGEVSGTVSTTAN
SPPLLSSPSTRPMLPPVSHMLGQQQGWVGMTKHPYNDHMFSLIPHQMGASHPGLGHSRGP
MLTPMNVTVSREQPPIVTFQMMAPGGGQGLLKQSQAGQVQVTQSQSHSQPGPAHLHCAQS
MMYQMPEQMSIGHGLPHTAPHPQTLGHGHGAMEGQSRQLPSYPPMQSPVDKYPTPPSQHS
YTTNGSEGTTPGHSAHPPSEHPYLTPSPDSPDPWSSSSPHSNSDWSDITTSPTPLGNITH
SRLRTTHTFQSRCSCSLRRSSTSRAPSSLSWGTCR
Download sequence
Identical sequences H3C6P3
99883.ENSTNIP00000003914 ENSTNIP00000003914 ENSTNIP00000003914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]