SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004012 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004012
Domain Number 1 Region: 30-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.76e-38
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 2 Region: 145-255
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-36
Family Spermadhesin, CUB domain 0.00032
Further Details:      
 
Domain Number 3 Region: 258-372
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-33
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004012   Gene: ENSTNIG00000014886   Transcript: ENSTNIT00000000113
Sequence length 376
Comment pep:novel chromosome:TETRAODON8:15_random:2325096:2327351:-1 gene:ENSTNIG00000014886 transcript:ENSTNIT00000000113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMGLRVAALIYLLLLVDKADSKKDHKGFKCGGILSAPSSNISSPNFPSPYPYNSDCSWLI
VVAEGSSVHLTFHHFELEYHASCSYDYIKIYNGVAEDEGNLLGMFCGDVSPPQFTSSWNV
MSIIFHSDRHVAYRGFSVGYRKDMCGGVLTGLSGEISSPGYPLEYNNNADCTWTIRVSSA
SVVTLVFLDFQLENNEGCNFDFVALFDGPTVAHRHLGNYCGAAKPPHVVTTSNNLLVVFK
SDFNIGGRGFKAYYYSGECQQVLSAVSGTFSSPRFPNIYPNNINCHWGITQAAGYRVKLF
FPFMDLEDQNSLSGECDYDSVTVYDGDSQTDAVLGRWCGRERPPSLISRSNKLLVVLRTD
RNGAYRGFTAAYLGGK
Download sequence
Identical sequences H3C0B5
99883.ENSTNIP00000001681 ENSTNIP00000004012 ENSTNIP00000001681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]