SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004019 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004019
Domain Number 1 Region: 27-135
Classification Level Classification E-value
Superfamily C-type lectin-like 2.76e-23
Family Link domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004019   Gene: ENSTNIG00000001093   Transcript: ENSTNIT00000003460
Sequence length 225
Comment pep:novel chromosome:TETRAODON8:13:5886490:5896134:1 gene:ENSTNIG00000001093 transcript:ENSTNIT00000003460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTLLLGVTFGLLASSRSELLKVNARSCSYARVFLVEGERRHFLNFDMAQKMCEQLNTTL
ASPEQAREAYYANMETCRYGWTNNGSTAILRHILHENCARNSTGFIVTSTVTPEDKFDAL
CYDENVGPEKNCEKQFKDGSDGLGQYWIHASKTVCLKKIVIPYCGVYLDSEISFMFFLIF
ITSQGREKRGLLVCQCCNTMIKYGGLRDLRACNWSIRWKVKVCVQ
Download sequence
Identical sequences H3C6Z8
ENSTNIP00000004019 99883.ENSTNIP00000004019 ENSTNIP00000004019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]