SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004209 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004209
Domain Number 1 Region: 80-123
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000479
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 2 Region: 36-85
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000682
Family EGF-type module 0.024
Further Details:      
 
Domain Number 3 Region: 119-147
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000805
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004209   Gene: ENSTNIG00000001836   Transcript: ENSTNIT00000004343
Sequence length 170
Comment pep:novel chromosome:TETRAODON8:Un_random:44681836:44682642:-1 gene:ENSTNIG00000001836 transcript:ENSTNIT00000004343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRALRPHARLSPWLLSATLAVQLRLGWGGRFCDKDLSVCVEKQPCRHGATCVMEDGRRRL
CGGLTCRCLAGFTGRRCEADVDDCLMAPCANGATCLDGVNRFSCVCPPGFSGRFCTVNLE
RCVSRPCSNGGRCIDRAGGFRCICQTRLHRNHLPDFAEGHAGAVQNSRDR
Download sequence
Identical sequences H3C7I7
99883.ENSTNIP00000004209 ENSTNIP00000004209 ENSTNIP00000004209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]