SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004344 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004344
Domain Number 1 Region: 5-71
Classification Level Classification E-value
Superfamily FAS1 domain 0.0000000288
Family FAS1 domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000004344
Domain Number - Region: 160-192
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000262
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004344   Gene: ENSTNIG00000001950   Transcript: ENSTNIT00000004483
Sequence length 270
Comment pep:novel chromosome:TETRAODON8:Un_random:46188225:46189734:-1 gene:ENSTNIG00000001950 transcript:ENSTNIT00000004483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVNTTRYHVVTAERLLKTDLQAGGYKQTMLGFSFQLRIFPLDGKLFVNNVQVNSSNMVSG
NGVIHGLSQVLSIVRNRCDETKYSKFRGSCVDCMFSRNKLCPNDTKSVRMKKCLFSHIFE
SERLLTIGCRTTCLRKNLVHRCCPGFFGEHCEPCPGPSGQPCYGNGVCVDGTNGTGLCQC
HKGFNGTACETCQGGKYGVHCDQDCSCKNGRCRTVSPATGPAIVTSAGEESPVRKRSTHW
TTCVAPSDVTPVPTASPWRQGSDASAPLAS
Download sequence
Identical sequences H3C7X2
99883.ENSTNIP00000004344 ENSTNIP00000004344 ENSTNIP00000004344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]