SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004388 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004388
Domain Number 1 Region: 3-68
Classification Level Classification E-value
Superfamily E set domains 3.94e-17
Family Filamin repeat (rod domain) 0.0000875
Further Details:      
 
Domain Number 2 Region: 72-122
Classification Level Classification E-value
Superfamily E set domains 0.0000012
Family Filamin repeat (rod domain) 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004388   Gene: ENSTNIG00000001986   Transcript: ENSTNIT00000004527
Sequence length 123
Comment pep:novel chromosome:TETRAODON8:Un_random:46624872:46626060:1 gene:ENSTNIG00000001986 transcript:ENSTNIT00000004527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WTREAGAGLSIAVEGPSKAEIAFEDRKDGSSGVSYIVQEPGDYEVSIRFNDEHIPDSPFI
VPVASPSDDARRLTVASLQESGLKVNQPASFAVSLNGAKGMIDAKVHSPSGALEECCITE
IDQ
Download sequence
Identical sequences H3C816
99883.ENSTNIP00000004388 ENSTNIP00000004388 ENSTNIP00000004388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]