SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004394 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004394
Domain Number 1 Region: 282-554
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.04e-73
Family Eukaryotic proteases 0.0000959
Further Details:      
 
Domain Number 2 Region: 166-274
Classification Level Classification E-value
Superfamily Kringle-like 1.67e-30
Family Kringle modules 0.00031
Further Details:      
 
Domain Number 3 Region: 62-100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000376
Family EGF-type module 0.04
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000004394
Domain Number - Region: 100-139
Classification Level Classification E-value
Superfamily FnI-like domain 0.000223
Family Fibronectin type I module 0.0037
Further Details:      
 
Domain Number - Region: 3-32
Classification Level Classification E-value
Superfamily Kringle-like 0.00911
Family Fibronectin type II module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004394   Gene: ENSTNIG00000006059   Transcript: ENSTNIT00000004533
Sequence length 561
Comment pep:novel chromosome:TETRAODON8:Un_random:84843066:84847332:1 gene:ENSTNIG00000006059 transcript:ENSTNIT00000004533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFTTSGHECKFPFRQGGRIHHHCITFLSSRPWIARLRCCCPTFKVLVFVFFFFVPVVVQS
PDPCKVNPCQNGGVCALVPRTDGFRCSCGKSFTGALCELRRCYETSHLRYFDAGESWGRI
HLRNVEQCTCAAGQVSCEKVRYTACRSNPCHNDGTCRLISSTGREVCSCRHGYGGAHCGV
DLDSECYNSKGADYRGAAGTTLSGGQCLPWNSDLLYDELHVGTVEASSLRGLGGHAFCRN
PDGDAMPWCYTLSDGAISWEYCRLPSCAMAVSSSRRLNPFHAAAVAKMPAPNRRSKQPVC
GRRHQKRLAMARGRILGGNSALPGSHPWMAAIYVGQQDFCAGTLVSSCWVVSAAHCFFRS
PLLSQIRVVLGQQRFNVTDHNSKTFGVEKYVLPEQFSVFNPTLHDIVLIKLKKQDGRCAR
RTPFISPICLPDKNTTFPDHFCCTISGWGHMHERGSTRVLAACEEAGVRLVPHHVCRRAE
VYGNHVTDGMLCAGLGGCADACQGDSGGPLACARDGVSFLYGVISWGEGCGRSGKPGVYT
NVLKYIDWIHSVLKRKSGKAS
Download sequence
Identical sequences H3C822
ENSTNIP00000004394 99883.ENSTNIP00000004394 ENSTNIP00000004394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]