SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004431 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004431
Domain Number 1 Region: 119-175
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000589
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 2 Region: 53-116
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000127
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004431   Gene: ENSTNIG00000002017   Transcript: ENSTNIT00000004571
Sequence length 213
Comment pep:novel chromosome:TETRAODON8:Un_random:46921983:46924029:1 gene:ENSTNIG00000002017 transcript:ENSTNIT00000004571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAARFTYAAFTCCFFQCCRGGGSRPEACAAGRPPWAPAPPCLAAGRKPTASRPCNSPCAG
WAASPWGACGGPCVGRGLATQHRHVYCRTPEPKVPEQTCGGLPRPGVQRNCSSRACAPQW
RLGPWTPCTATCGGHGFQSRQVTCAHLGSGKAAKEHQCTWRPRPPSWQRCHLQPCAPAGR
CQDSSRYCQKVGQLQLCLLPQFRKRCCQSCRNT
Download sequence
Identical sequences H3C859
ENSTNIP00000004431 99883.ENSTNIP00000004431 ENSTNIP00000004431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]