SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004449 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004449
Domain Number 1 Region: 729-837
Classification Level Classification E-value
Superfamily C-type lectin-like 3.54e-34
Family Link domain 0.00034
Further Details:      
 
Domain Number 2 Region: 286-431
Classification Level Classification E-value
Superfamily FAS1 domain 9.68e-26
Family FAS1 domain 0.0036
Further Details:      
 
Domain Number 3 Region: 125-279
Classification Level Classification E-value
Superfamily FAS1 domain 1.19e-20
Family FAS1 domain 0.0021
Further Details:      
 
Domain Number 4 Region: 22-75
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family EGF-type module 0.049
Further Details:      
 
Domain Number 5 Region: 670-706
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000128
Family EGF-type module 0.055
Further Details:      
 
Domain Number 6 Region: 60-116
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000261
Family EGF-type module 0.042
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000004449
Domain Number - Region: 506-543
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00953
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 713-732
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0577
Family Merozoite surface protein 1 (MSP-1) 0.073
Further Details:      
 
Domain Number - Region: 538-719
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0785
Family Growth factor receptor domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004449   Gene: ENSTNIG00000002033   Transcript: ENSTNIT00000004589
Sequence length 853
Comment pep:novel chromosome:TETRAODON8:Un_random:22964238:22969783:1 gene:ENSTNIG00000002033 transcript:ENSTNIT00000004589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGFRCLCAAGFIGNGTSCQVARDACALNNGGCSVNAVCKRTLPGRRDCVCHSGFSGDGLV
CVEINACLEGSQGCHENADCLHVGPNKTSCTCHDGYAGDGHHCQMINLCLKKNGGCGDNA
RCNMSAPGVRTCTCSANYVGDGFSCRGTVAKELLKKKLRDFYLGLMMMEIPLKGRGPFTV
FAPSSDAFEQIKKGKVFQKLPLSGEHFATILRSHIVMCHTLLPVDLSRPRNLTSLSGLVL
TTSSSQGHIFINQANVTYSDEVSVNGILHVVDQVLVPPDINRTSGACQLNLSDVAERHGY
KTFYKLLEDSGVLDLLKEEVHQPLTLLLPSDQALDSLLPEQKNFLFHRENRPQLLEYLKF
HVLPAQKVYAEDLVHLASPRTLQGSPLSFRCGGTDAVGEIFVNDGACRIVQRHLGFPGGM
AFGIDCLLTPPSLGGRCDVQTTFDFSMACAMCSSSATRCPQGSRGAEVRPPVRLHRPQLR
CRSICAVSVWQSRCCHGYYGRDCLACPGGAGSPCSNHGNCDDGHLGNGTCACDPGFGGVA
CELCSDGFYGAACEACDCAEHGSCDSGRGGTGACFCDAGWGGRRCESQGDQLPGCSPACS
PNAVCQDNNTCVCRPFYQGDGLTCTGVQSVQVMNGGCAAHGQVLPGGCSCAKGYGGDGYV
CTPLDPCASGDNGGCHQHATCTMTAPGKRKCSCKQNFIGDGLVCEPRQLPVSRCLQDNGG
CHLDAQCSDLHSEDAQLGVFHLRSDRGQYQLNYTAAQQLCAAQGASLATYSQLSYAQQGG
MNMCAAGWLDQARVAYPTTYSNPLCGFGHVGIVDYGPRRNLSETWDAFCYRMKANPELLP
GVGGGPALREAPE
Download sequence
Identical sequences H3C877
ENSTNIP00000004449 99883.ENSTNIP00000004449 ENSTNIP00000004449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]