SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004479 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004479
Domain Number 1 Region: 370-551
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-39
Family Laminin G-like module 0.0016
Further Details:      
 
Domain Number 2 Region: 585-795
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.46e-38
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 3 Region: 794-995
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.07e-38
Family Laminin G-like module 0.00058
Further Details:      
 
Domain Number 4 Region: 39-235
Classification Level Classification E-value
Superfamily Fibronectin type III 8.78e-33
Family Fibronectin type III 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004479   Gene: ENSTNIG00000015799   Transcript: ENSTNIT00000004620
Sequence length 1019
Comment pep:novel chromosome:TETRAODON8:12:7472001:7484194:-1 gene:ENSTNIG00000015799 transcript:ENSTNIT00000004620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPTWKGRSLLHLLLLSMCAAPVCFSARRSNVRRSDRLSPPLDIQLETINCSAFSVRWKM
PRRHVSTITGYKVFYTEVRSGRPLGVASATEVPLSLDMLTTDVEIAHLKVNTKYRVSVGA
YGWAGEGRPSMPRDVSTGSHDTCMPPSPPTQPAVMAVSDTELALSWQQGESEGSAPVLHF
LVAYIRPEMDTEWTYIREPIETNSMVLKGLLPETEYQFVVRAVNVHGASPPSHINNPVRT
LATSDGGSGDYGGYITDFRTNDDDRFDIDDSDYDIFIEELKPFPGINQLNTARFKRELKK
ISLSKEKLIFVFFSLKIPSTALPSTTTAATTPTMSPWKGDTPRVYDLTCDDTVCPPDSFC
LSDYDGGGSRCHCNLGWRGNTCSDVVQVTFPRFYGYSHMTFEPLKNSYQTFQITVEFKAE
NEDGLLLYCGENEHGRGDFTSLALVRGKLHYRFNCGTGAAQIVSESGVVVGQWHTVTIFR
DGMSGWLRMDNDTPISGRSQGQYSKITFRSPLYVGGSPTAYWLARATGTNRGFVGCIQSL
SINNRLTDLRAWPVGRALSGADIGECSDSVCEQVYCANGGVCFPNRADGYICLCPLGFRG
PLCAERFSLSSPLFNETVFSYAAVPWPQSSQSYLSFMEFEVTFRPSSPDGTLLYSDDKGS
GDFLAINLVDRYVEFRFDCGSGGATIRSVEQISMDAWHELRVSRTAKSGILQVDSQRPVE
GITEGAFTQIKCSSPLYIGGVPEYDKTKKTAGVEKPFTGIIQKLILNDRTIPITVGPASG
INVANSEHPCVENPCANGGSCRPKWDSYECDCPLGYDGKHCQKECGNYCLNTVAEAIEIP
QFIGRSYLTYDSRDILKRVSGSRTNLFMRFKSTAMSGLLLWRGDSPMRANSDFLSLGLQD
GALIFSYNLGSGTVNIAVNGTFNDGKWHRVKAVRDGQSGKLTVDDYGAKTGRSPGKMRQL
NINGPLYVEGGMKEISLHTNRQYSGGLVGCVSHFTLSTDYHLALVEDAADGKNINTCSN
Download sequence
Identical sequences H3C8A7
ENSTNIP00000004479 99883.ENSTNIP00000004479 ENSTNIP00000004479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]