SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004488 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004488
Domain Number 1 Region: 38-222
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.21e-32
Family Laminin G-like module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004488   Gene: ENSTNIG00000014876   Transcript: ENSTNIT00000004629
Sequence length 1802
Comment pep:novel chromosome:TETRAODON8:15_random:2086472:2135619:-1 gene:ENSTNIG00000014876 transcript:ENSTNIT00000004629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRWNTRWKTKRWLWDSTLTVAVIVILILQVVTVRAADPVDILKALDFKSSPEGVRKAPG
FCTLRRGGKPDIAYRVSKTAQISTPTKQLFPGGVFPQDFSIMFTIKPKAGLQSFLLSMYN
HQGIQQLGVEVGRGPVFLYEDQHGKPSADEYPLFHSVNLADGKWHRVALSVDKKSVTIIV
DCKKKVTRPLRRSNRAVIDTEGITVFGTRILDEEVFEVRWSMLNQDRAAFLITTGIKNDI
SLIEKHIQAKQPARQWHTPITELIKGYTGYEYGEIYDYTEGELTTDAPPTEQAKTETQVD
GDFYAGEYDYITLDGSQPETGTETTGQGQNYDGEIVDDYITGIEQVGADPTVTVETVVPV
ETVVPVDTKEEVDPAPNEYEFKEYDLKEYGTKDFAYEEEFGPGVPAETDIRESDVGRGHS
YLGEKGEKGEPAVIEPGMLVEGPPGPPGHAGVPGTPGLQGPLGPPGDPGARGPPGRPGLP
GADGVPGLPGTILMLPFRAGGASHKGPVVSAQEAQAQAILSQARLAMRGPPGPGGLMGRS
GPIGGPGAPGLKGDGGDSGPPGPRGLQGPTGPPGKSGKRGRNGADGARGIPGEAGPKGDR
GFDGLPGLPGEKGHRGEQGSTGPPGSPGDDGPRGEDGPVGQRGVAGESGPRGLLGPRGSS
GPAGQPGLPGIDGPPGPKGNMGPQGESGPPGQQGLPGPHGLIGPQGPIGPPGEKGPQGKQ
GVAGLAGADGPPGHPGKEVPLARKGAPGPIGSIGYPGPRGVKGADGIRGLKGGKGEKGED
GFPGFKGDMGLKGDKGENGAQGPRGEDGPEGPKGKSGPGGELGPPGLAGEKGKLGVPGLP
GYPGRQGSKGSNGFPGFPGANGEKGTRGLGGKPGPRGQRGPTGPRGGRGARGPTGKPGAK
GTSGNDGPPGPPGERGPQGPQGPLGFPGPKGPNGPPGKDGLPGHPGQRGETGFQGKTGPP
GPGGVVGPQGPTGGTGPSGERGHPGPPGPPGDQGLPGAAGKEGGKGDPGPQGPSGKAGPP
GLPGFQGQRGLPGGMGQAGLKGGEGPQGPPGPIGSSGERGAAGPGGPIGLTGRNGPQGPP
GPAGEKGAPGEKGDVGPAGRDGIQGPIGLPGSAGPQGQPGEDGDKGEVGGPGQKGSKGDK
GELGPPGPAGLQGVIGAPGPAGSDGEAGPRGQQGMFGQKGDEGPRGFPGLPGPVGLQGLP
GPPGEKGENGDVGAMGPPGPPGPRGPQGPGGTVGPQGPPGGVGSAGAVGEKGEAGEAGNP
GPQGEPGVMGRKGETGEKGDTGPPGAAGPPGLRGPPGDDGPKGNPGPVGFVGDHGPPGEP
GTAGIDGLPGDKGDDGEPGQPGPPGPSGEAGVPGPPGKRGSVGPAGKEGRQGEKGSKGEA
GAEGPVGKTGPVGPQGPPGKSGPEGLRGIPGPVGEQGLPGASGRDGPPGPLGPPGLPGMK
GDSGSKGEKGHPGLIGLIGPPGEPGEKGDRGLPGLQGTAGGKGDSGAGGFQGPLGPPGPP
GLPGTIGQKGSKGSNGAQGQKGDPGLVGPPGPPGPPGDMIQPLPVQHSNKRSRRQAEMQG
ADAGGRLRRSSGIDDVFGSLNNIKQDIERMKFPMGTQDNPARTCNDLLLSQPDYPDGEYW
IDPNQGCTGDAIKVFCNFTAGGETCIYPDKKSAGVRISNWPKETPGSWFSEFKRGKILNY
VDVEDRTITTVQMTFLKLLSSAARQNFTYICHHSVAWYDAKADNYDKARFLGSNDEELSY
DNNPYVKPLTDGCSLKQGYSKTVMEINTPRIDQLPIIDVMLNDFGESNQRFGFEVGSVCF
LG
Download sequence
Identical sequences H3C8B6
ENSTNIP00000004488 ENSTNIP00000004488 99883.ENSTNIP00000004488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]