SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004494 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004494
Domain Number 1 Region: 137-269
Classification Level Classification E-value
Superfamily BEACH domain 1.44e-43
Family BEACH domain 0.0000274
Further Details:      
 
Domain Number 2 Region: 46-132
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000697
Family GRAM domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004494   Gene: ENSTNIG00000002065   Transcript: ENSTNIT00000004635
Sequence length 269
Comment pep:novel chromosome:TETRAODON8:Un_random:47224307:47225818:-1 gene:ENSTNIG00000002065 transcript:ENSTNIT00000004635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLQLHRASCLEKLGDQAAMIAANLQSRLARTSFDKNCFQSVCERPHLECAAEMVLPLVCN
PGHVCITDESLYFQPLNGYPEQVIHIKLHAVRRIYKRRHGLRPLGLEVFCTENDFCSDIY
LKFYSPADRDEYGYTATFLENHVTEHTAESYMLQWQRGLLSNYQYLLHLNNLADRSCNDL
SQYPVLPWIIADYSSGQLDMTNPATFRDLSKPVGALNPERLDRLLSRYTAMPEPRFMYGS
HYSSPGYVLFYLVRVGEPPPEHMLCLQNG
Download sequence
Identical sequences H3C8C2
99883.ENSTNIP00000004494 ENSTNIP00000004494 ENSTNIP00000004494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]