SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004504 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004504
Domain Number 1 Region: 436-489
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000017
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 2 Region: 34-82
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000863
Family TSP-1 type 1 repeat 0.0017
Further Details:      
 
Domain Number 3 Region: 377-438
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000994
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 4 Region: 297-360
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000144
Family TSP-1 type 1 repeat 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004504   Gene: ENSTNIG00000002074   Transcript: ENSTNIT00000004645
Sequence length 526
Comment pep:novel chromosome:TETRAODON8:Un_random:35641472:35647275:-1 gene:ENSTNIG00000002074 transcript:ENSTNIT00000004645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FGCWRRGQEGGLRLLLPALLVLSSRTARSEEDRDTLWDAWGSWSECSRTCGGGASYSLRR
CLSSKSCEGQNIKYRSCGTADCPPEAGDFRAQQCSAHADVRFQGRYHEWLPVYDDPENPC
ALKCRARDSGLVLELAPKVLDGTRCYSASLDMCISGACQVVGCDRQLGSAATEDNCGVCG
GDGATCRLVRGHYRSQQDSGRNEDTVVVVPHRSRHLRLVLKGPDHLYLESQTLQGVLAQL
DPEESGLHQLENTTLDFQKLPQKEVLRTAGPLGADFTVKVRLASGAASTVQYSFYQPIVH
RWRETDFFPCSVSCGGGYQLTSAECLDLRSGRVVADQDCQHHPENVKPKPRLQECSPEPC
PASDGYKQIMPYDLYHPLPRWESGPWTSCSASCGGGVQSRSVSCVEEDVQGVATAAEEWK
CLYAPKADALQACNDFACPGWLAQDWSPCTATCGQGLRYRVVLCMDQRGLHAGGCDPTAK
PPIKEACLAALPCYKPPDTLPVEAKPAWHKQAIEFQESSAATRPRS
Download sequence
Identical sequences H3C8D2
99883.ENSTNIP00000004504 ENSTNIP00000004504 ENSTNIP00000004504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]