SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004535 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004535
Domain Number 1 Region: 14-110
Classification Level Classification E-value
Superfamily Cap-Gly domain 2.09e-31
Family Cap-Gly domain 0.0000191
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000004535
Domain Number - Region: 905-1037
Classification Level Classification E-value
Superfamily Tropomyosin 0.00981
Family Tropomyosin 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004535   Gene: ENSTNIG00000010541   Transcript: ENSTNIT00000004676
Sequence length 1114
Comment pep:novel chromosome:TETRAODON8:10:12268539:12279618:1 gene:ENSTNIG00000010541 transcript:ENSTNIT00000004676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQSRRTVHTRTPGRMSSDGGGRPARIGSLVEVIGKGQRGTVAYIGNTLFASGKWVGVIL
DEAKGKNDGTVQGKRYFSCEENHGIFVRQSQIQLVEDGADTTSPDTPEPTSGKVPRRDVL
ESSKSSKVTKQRGVKPKKVLHVSLTRRTTARRPKQPGRAAASAGKGAASGSASASAGEMS
SSEASTPAQTPLAAPVIPSLYSPGNPAPPAPSKEEEALRGQVKDLEEKLETLRMKRTEDK
AKVKELEKHKIQLEQLQEWKTKMQEQQAELQKHLKEAKREAKEALEAKERYMEEMSDTAD
AIEMATLDKEMAEERAESLQLEVDSLKEIVDELTMDLEILKHEIEEKGSDGAASSYHVKQ
LEEQNARLKEALVRMRDLSASEKQEHVKLQKQTEKKNMELDTQRSQKEKLQEEMAAAEKT
IDELKEQVDAALGAEEMVEMLTERNLDLEEKVRELRETVADLEAINEMNDELQENARETE
LELREMLDLGAARVREADKRVEAAQETVADYQQTIKKYRELTAHLQDVNRELTSQQEASA
EQQQPPPPAEMFDFKIKFAETKAYAKAIEMELRKMEVGQANRHVSLLTSFMPESFLRHGG
DHDCILVLLLIPRLICKAELIGKQAQEKFDLNETCVERAGLRGAVGEQLSFAGGLVYSLS
LLQATLHKYEQSLAQCSVEVYKKVGSLYPEMSVHERSLDFLIDLLHKDQLDETVNVEPLT
KAIKYYQHLYSIHLTEQPEDCTTQLADHIRFTQSALDCMAVEVGRLRAFLHAGQEKADLA
VLLKDLETSCSDIRQFCKKIRRRMPGTDAPGIPAALSFGQPVSDTLSDCRKHLTWVVAVL
QEVAAAGAQMMSPLGEQEGLSAAKMEDVAFKAGEQIYGSQGANPYDCLRQSCSVVIATMN
KMATAMQEGEYDAEKPQNKNPPPVEARAAALRAEITDAEGLGMKLEDRETVIKELKKSLK
IKGEELSEANVRLSLLEKKLDSSSKDADERVEKIQIQLDEAQTLLKKKEKDFEETMDALQ
ADIDQLESEKAELKQRVGSQSKGGPEGRGGGSSGIASVVTGLAGEEEKGSPAAIVSGVGS
ASGLQVIDSPLLTQQIEAQRLCIKQLKNENNRLK
Download sequence
Identical sequences H3C8G3
99883.ENSTNIP00000004535 ENSTNIP00000004535 ENSTNIP00000004535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]