SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004565 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004565
Domain Number 1 Region: 237-287
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000586
Family Laminin-type module 0.0073
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000004565
Domain Number - Region: 201-239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000156
Family EGF-type module 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004565   Gene: ENSTNIG00000002130   Transcript: ENSTNIT00000004706
Sequence length 322
Comment pep:novel chromosome:TETRAODON8:Un_random:48118905:48120645:-1 gene:ENSTNIG00000002130 transcript:ENSTNIT00000004706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XPRGCTACFCFHHSSVCESADGFSVHTITSSFQRADNERWTAQQRDGSSVAVQWSPSKQE
VFLTSEDYFPLYFLAPGQVLGEQMLSYGQNLSLSFRVDRRDTRLSAEDLVLEGAGMRVAV
PLIAQGNAYPNENMQTYVFRLHDSSDYPWRPTVSHADFQKLLHNLTAIMIRGTYSERSAG
YLDDVSLVTARRAPGIAARWVEQCTCPQGYQGQHCERCTVGYRRTRPELAFSACEPCSCN
GHSDSCNPDTGACDCQDNTAGLSCERCRDGFYGDPVGTAADCHPCPCPAGATCAVVLRSK
EVVCTNCPAGTTGGSGCGSCRD
Download sequence
Identical sequences H3C8J3
99883.ENSTNIP00000004565 ENSTNIP00000004565 ENSTNIP00000004565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]