SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004635 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004635
Domain Number 1 Region: 159-344
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.72e-22
Family SPRY domain 0.014
Further Details:      
 
Domain Number 2 Region: 374-523
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000878
Family Nucleotide and nucleoside kinases 0.024
Further Details:      
 
Domain Number 3 Region: 5-42
Classification Level Classification E-value
Superfamily SAP domain 0.0000000275
Family SAP domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004635   Gene: ENSTNIG00000009725   Transcript: ENSTNIT00000004778
Sequence length 757
Comment pep:novel chromosome:TETRAODON8:14:9150591:9156904:-1 gene:ENSTNIG00000009725 transcript:ENSTNIT00000004778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSIDVKKLKVNELKDELKKRNLLDKGVKAQLMDRLQAALDEEAMASRLDEEAAEDDAFE
QPADQEVMLKADVDDMEKIDADDGEPGDQAAEVLDSKRSNSLIDFNKGDADKDTNADQKN
KKGVKRRREEHGRGYYEFIEENKYSWGSSFKSPVPPLEEEDEEIDDTKVCLDAYNCDLHF
KVSRDRYSASSLTMESFAYLWSGGKATYGVNKGKACFEMKITEKIPVKHISNKNTDIHDV
QVGWSLATGTLLLGEEEFSFAYSSKGKKTTKCVTEEFGETFEENDVVCCLIDCDGDEVVM
SYCKNGGEPATAFRISKDGLDGQALFPHIICHNCAVEFNFGQMETPYFPQPEGFTFLQQI
PVDDRVRGPRGPQTKADCEIIVMVGLPGSGKTTWVKNHVQEHPGKYYILSSDTIVDKMMI
NSLKRQSKDITKLTTISQRAPLFLGKFIEIAARKKRNYILDHTNVSAPGQKRKCLFAGFQ
RKAVVVCPSEEDYKQRVQQKVETDGKEVPEHAILKMKGFYALPEEGDSFGEVLYAELQKE
EASKLLEQYREESKTALPAEKKPNQGSTMPKRGGGQRGGGRGGKNQFGRGAGPGHRGGGR
GGFQNRGNYRGSAGPGPHCGFSRPPRNFLPPLNIRGGPGRGNFNRGHMPILGGSPRGGPM
RGNMGPRGGHMNRGGPGHRGNMKMNRGGHRGHPGHYNQRGGNRGNFGNKNGNFNNRNSGN
FGGNRNGMDKAQAFNQSWQQGFWSQKPWNQQYQPGYY
Download sequence
Identical sequences H3C8R3
ENSTNIP00000004635 99883.ENSTNIP00000004635 ENSTNIP00000004635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]