SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004701 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004701
Domain Number 1 Region: 89-132
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000171
Family EGF-type module 0.013
Further Details:      
 
Domain Number 2 Region: 42-81
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000838
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000004701
Domain Number - Region: 9-43
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000111
Family Laminin G-like module 0.035
Further Details:      
 
Domain Number - Region: 142-163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0559
Family EGF-type module 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004701   Gene: ENSTNIG00000002241   Transcript: ENSTNIT00000004844
Sequence length 224
Comment pep:novel chromosome:TETRAODON8:Un_random:44742452:44743437:-1 gene:ENSTNIG00000002241 transcript:ENSTNIT00000004844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVPAAPDAVNVSGFHGCIRKLYINHELQDFTRSHMGAGVEPGCQACRQSYCAHGTIWVLT
GSPAQGPRCHCHPGWVGPRCDRPATAEGVTVATGVDPCADSRCVQGACVPVDARTYRCDC
RDGYEGALCHLQRHRPAGAAACPHGEGGRCACEDGFSGQSCDIELPCGGQPVRDHHRLRR
GSALCQTAKPFSWVECRGRFQCDDGTTFTQDVEKPVECGCKECV
Download sequence
Identical sequences H3C8X9
99883.ENSTNIP00000004701 ENSTNIP00000004701 ENSTNIP00000004701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]