SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004904 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004904
Domain Number 1 Region: 268-304
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000114
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 2 Region: 167-258
Classification Level Classification E-value
Superfamily PKD domain 0.00000102
Family PKD domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004904   Gene: ENSTNIG00000019126   Transcript: ENSTNIT00000005050
Sequence length 462
Comment pep:novel chromosome:TETRAODON8:14:2068441:2071447:-1 gene:ENSTNIG00000019126 transcript:ENSTNIT00000005050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTLLSGRRVDARSSPISDLKSKISGVEELLEEFRQQLQQEQSYKLGGVADSCVGDFSSVG
DSIIQAKASIEQGATFLLAPKRVYTWRDCVHACCSQPHCTVAVIQEEQGLPGADLDCYLF
NCTYRGQHVCSFAPQPGFSAYSREANTRAAAGVSARSPLSPGAGVDEPPRSDAGQDVVIQ
LPTDWAVLDGRDSVDDRGIAHYAWTLVRGDTAISMKVPHPGLLKLGQLQEGVYTFKLTVT
DTRGQKSSDDVSVTVLPPKHQAEVCSGRCSSYQFKCDDGCCIDITYACDGKQHCPDRSDE
DFCSDFDGGRKSVTHPAAGDGSTLQAGAGRAAGAPESLSKAETPEAPASAAPPVTRQTET
GKDQHSNVLTLDGGQTSLHSSSPASRGHAGSQAPVSKPAPAMGGHPAPETAGAVLPLALG
LIITALLLLMISCRLRLVRHKLKKARPLSTEESDYLINGMYL
Download sequence
Identical sequences H3DP74
99883.ENSTNIP00000022323 ENSTNIP00000004904 ENSTNIP00000022323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]