SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005100 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005100
Domain Number 1 Region: 47-198
Classification Level Classification E-value
Superfamily Kelch motif 3.92e-29
Family Kelch motif 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005100   Gene: ENSTNIG00000002549   Transcript: ENSTNIT00000005246
Sequence length 201
Comment pep:novel chromosome:TETRAODON8:Un_random:22357591:22360070:-1 gene:ENSTNIG00000002549 transcript:ENSTNIT00000005246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKKGKKDKKVKGAEKTAAKMEKKISNRSKREEEDLEALIAEFQNMDAKKTQVVEIPCPP
PSPRLNASLCAHPEKDELILFGGEFFNGKKEYMYNDLFFYNIRKNSWVKAEIPTPPPPRC
SHQAVVVAQGGGQLWVFGGEFASPNGEQFYHYKDLWVLHLATHTWENIKAPGGPSGRSGH
RMVASKKQLLVFGGFHENSRL
Download sequence
Identical sequences Q4TC11
ENSTNIP00000005100 99883.ENSTNIP00000005100 ENSTNIP00000005100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]