SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005153 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005153
Domain Number 1 Region: 758-934
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.12e-43
Family MAM domain 0.00046
Further Details:      
 
Domain Number 2 Region: 250-338
Classification Level Classification E-value
Superfamily Immunoglobulin 4.17e-17
Family I set domains 0.012
Further Details:      
 
Domain Number 3 Region: 353-441
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000124
Family I set domains 0.026
Further Details:      
 
Domain Number 4 Region: 446-554
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000199
Family V set domains (antibody variable domain-like) 0.045
Further Details:      
 
Domain Number 5 Region: 53-137
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000924
Family I set domains 0.042
Further Details:      
 
Domain Number 6 Region: 549-641
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000348
Family I set domains 0.08
Further Details:      
 
Domain Number 7 Region: 155-222
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000795
Family I set domains 0.062
Further Details:      
 
Domain Number 8 Region: 667-752
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000721
Family Fibronectin type III 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005153   Gene: ENSTNIG00000002601   Transcript: ENSTNIT00000005299
Sequence length 968
Comment pep:novel chromosome:TETRAODON8:Un_random:53365126:53374972:-1 gene:ENSTNIG00000002601 transcript:ENSTNIT00000005299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKMDAASLLLLCLLTGSLRAARGQGVYAPPTVRILHPRQPCNLQEERYAERVFTIREGAT
LELQCLVTGHPRPQVRWTKTVGGASERQVGPPLHNETLKIGNISRHQGGRYYCKADNGLG
SPAIHSIRVDVYYLDDPVIWVHQSVGEMKEQFYFERTVFLRCAANGNPPVRYTWRRGHEV
LSQGSDAGVEIYEPFFTQQGETKILKLKNLRPQDYAEYSCISSVRSICGIRDKIAHFSLT
NQTGVSSVKLLPEEPLVVNPGQTITLVCVASGGEPPPRLSWLRPGGEELPERSAVNGGTL
TIPAATVEEGGAYTCLATNNVGGPVKKSVSVLVRGLRKARFWITPDPYHNDDNIQIGREV
KISCQVEATPPEELQFVWLKNGRPLRSSERMVITHTDASVSPGTTNLDIIDLKFTDFGTY
TCVASMANGGSPEISIDVNISSTTVPPELSVPRGRSHLTAQEGDTVDLQCLVSGKPKPIL
LWSRVEESSAAAAVAPPTMPDGSAQTESYDGVLRISNVSRDMSGTYRCQTSQYNGFNVKP
REALIHLVVQFPPVVEPTFTEVRQALGRAFSLTCRLLQAHPARLLRYEWKLGPRLLTVGQ
FGHQRDDTTYTVKALNREGYGEYTCDITNEVGAGRCTFLVTGKAYAPEFYYDARGALWQN
RPRYGFKLQWTQMEPGAVDRILAYRLGFRQMSQSRWWEQQIPIEGTIQKGELLTYNLTEL
IKPESYLVRLTPITRFGEGDTTERTISYSTPVNPHLKEFQCGFEEEAICLFTQDKTDEFD
WTRHSAATRNTKYTPNTGPSSDHNGSKQGYYMYIETSRPRQDGDKARLLTPTFNTNSRSS
ASLGHSPAYCFSFYYHMYGKHIGALSVFLRQKGPTVTDTSVWSLSGNQGDRWQQAKVNIQ
PSTAFPVLIEGVRGSGIEGDIAIDDVAIQEGQCTHPPSNNLRSLAPPPAPHLWLLGVPLS
MALIGFQR
Download sequence
Identical sequences H3CA81
99883.ENSTNIP00000005153 ENSTNIP00000005153 ENSTNIP00000005153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]