SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005284 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005284
Domain Number 1 Region: 591-776
Classification Level Classification E-value
Superfamily vWA-like 4.06e-52
Family Integrin A (or I) domain 0.00043
Further Details:      
 
Domain Number 2 Region: 980-1166
Classification Level Classification E-value
Superfamily vWA-like 8.9e-51
Family Integrin A (or I) domain 0.00034
Further Details:      
 
Domain Number 3 Region: 386-570
Classification Level Classification E-value
Superfamily vWA-like 6.94e-50
Family Integrin A (or I) domain 0.00076
Further Details:      
 
Domain Number 4 Region: 2-182
Classification Level Classification E-value
Superfamily vWA-like 1.95e-49
Family Integrin A (or I) domain 0.00043
Further Details:      
 
Domain Number 5 Region: 201-379
Classification Level Classification E-value
Superfamily vWA-like 1.31e-45
Family Integrin A (or I) domain 0.00025
Further Details:      
 
Domain Number 6 Region: 784-977
Classification Level Classification E-value
Superfamily vWA-like 9.95e-45
Family Integrin A (or I) domain 0.00077
Further Details:      
 
Domain Number 7 Region: 1750-1940
Classification Level Classification E-value
Superfamily vWA-like 5.49e-29
Family Integrin A (or I) domain 0.0055
Further Details:      
 
Domain Number 8 Region: 1966-2142
Classification Level Classification E-value
Superfamily vWA-like 6.49e-26
Family Integrin A (or I) domain 0.0017
Further Details:      
 
Domain Number 9 Region: 2380-2436
Classification Level Classification E-value
Superfamily BPTI-like 2.55e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0013
Further Details:      
 
Domain Number 10 Region: 1184-1387
Classification Level Classification E-value
Superfamily vWA-like 0.000000000223
Family Integrin A (or I) domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005284   Gene: ENSTNIG00000002726   Transcript: ENSTNIT00000005430
Sequence length 2436
Comment pep:novel chromosome:TETRAODON8:Un_random:54214616:54227540:1 gene:ENSTNIG00000002726 transcript:ENSTNIT00000005430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVADIVFLVDGSSSIGPSNFQEVRLFLRSLASGLNVSPDNIRIGLAQFDEPHQEFLLKYH
IEKMNLLAAFESFPYRNGGTETGKAINFLRKQYFTKKAGSRADQRVPQIAVVITDGDSTD
DVVVPARELRKHGVIVFAIGVGNANQGELKSIANRPSERFKFTIDSFQALKRLTERLLET
MCVSMEDQHQVFPSALKEKFADVFILLDGGITQAEFRQIRTFLGSLVNQLNFSPSTYRLG
LAQYGQDIKVDFLFKDHQTNKDLLTAVKNAQQHHGGGTNTGAALNFTQHQVFVREKGSRI
ELGVQQVAVVITDGRSQDDVSTPAANLRAGVTVYAVGVKDADEAQLHQIASYPTKEHTFT
VDSFSKLKTLETSLQRVMCQNVIQQGCVETEEADIFFLIDQSGSIHPPDFYDMKKFILEF
LQTFRVGPNHVRIGVVKYADSPTLEFDLHTYTDVKSLEKAITNIHQVGGGTETGKALDFM
RPQFDRAVTTRGHKVKEYLVVITDGNSTDKVKDPADKLRAQGVVVYAIGVKDAVEKELLE
ISGEPQRTFYVNNFDALKPIKDDIITDICSTDAAVFRKFWVELGGSDLSLLSTVCKDVPG
DLIFLIDSSGSIYPEDYQKMKDFMKSLVQKSNIGKDQVHVGVLQYSTEQKLVFPLIQYYT
KDQLSKAIDDMQQIGGGTHTGEAIAVVSKYFDAQNGGRPDLKQRLVVVTDGESQDDVKLP
AEALRAKGVIVYSIGVVAANTSQLLEISGDADRMYAERDFDALKDLEKQMALEICDPDRV
EVRPVISDCKKTAQADIIFLVDVSTSILKEKAFPSVTVFMESVVNQSSVGPELTRFGVIT
FSTGVQSIFTLKQYSSKRDVLQAVGAVTAPGGNTNTGDALDYSLQYFGKEHGGRAALKVP
QILMVITDGAAQEPSKLPGPSEALRKQGVSVFSIGVKNASREQLDIMAGNDPSRVFFVDT
FDALETLYKNISKVLCNHTKPVCEKQKADLVFLLDQSGSIQSDDYTTMKKFTIDLINKFQ
ISRDLVHVGLAQFSSTFKDEFYLNKFFDEQAISAHIKDMQQEEGGTLIGLALNSIRKYFE
ASHGSRKAEGISQNLVLITDGDSQDDVEEAARLLRGLGVEVFAIGIGNVHDLELLQIAGT
PENVFTVKNFDKLEGIHQKVVDTICQSKPIPDPSRPNGTHLVAGCSIDIAMGFDISRRSG
APGETLVSGHAALRNFLLEIADYVSSISGLCCTDSKPVQTNIGYRVVRQDGSTLYDFNFE
PHSSEVVKKVMTSSVATPTSFNTALLKSFQEKFRQSQGLVLVIFSDGLDEDVIKLEEESE
RLRLSGRVSALLLVALEGTSLGQLQMVEFGRGFGYKVPLSISMPSVGSTILKQIDMVSDR
ECCGVMCKCSGHEGVRGLRGSPGSKGVTGQQGYPGFPGEEGVAGERGRPGPSGPQGVQGC
SGPRGLVGNRGLRGNRGENGEDGLNGVDGEQGDAGNDGSRGERGHAGNPGIPGIRGEAGL
KGERGLRGDPGEPGTRNTVQGPKGDPGSPGLPGPTGMDGEPGKDGANGQQGPDGRRGPPG
EKGFTGKPGDAGPPGLPGASGPVGSRGNKGDTGPPGVAGLPGPQGGPGPAGNPGASGRRG
VVGPKGQPGEPGQQGVPGPQGPRGLPGQDGKDGYGPAGPGGVKGDPGFPGYPGLVGENGL
QGPKGTPGPKGNQGQPGKAGPAGESGLSGEPGYAGHRGPRGPPGKPAMTECQLITYIKDN
CACSSHHPRCPVYPTELVFGLDMSQDVKPADFQRQRAALLSLIEDIAVSESNCPTGARVA
VVGYSSYVKHLVRFQDYRRKEQLLEFVKNIPLERSGNSRRLGGAMRFVGHNVFKRVRAGA
VTRKVAVFFSNGLTQDDGDLVAAVMEYRGLGVVPAIVSLKNAPSVSRALELDDSGNAIFS
VLGRDAVASLQKVKDCAICYGSADPCQRSQQCSFIQEKLGPQEANLDLALVVDGSREVQA
DQFAGIQQLLGSVVEQLAVSPQPRKPGDQARVAAIQQSSAQVQAEFGLQVYQNHKLMRRH
LVQNMQQQAGSSALGHTLDFALNQVLLKASHPRQRRVLFAVVATQTAQEDAAQLRYVAQK
ARCEGVALFVVTVGNRYNRTEVEEIASTPLPQHLVHVGGMKADEQAYICRFFRVFVNALN
MDINTYPPPSLKASCDQLGQDGGQSSVAAAPDAPDGAVSVRPVRCWSWETRPSRSSWDGG
RTPASWTSETDADWWPEATLTVTLPLTLKLSLLAASSRKPPVAVVCPLSPASVELSACFS
GMRNHHRCMWFSCGGPPPIGRRCRGAAALLCQICSAPLDEGNETASVVMTGLLWSRQWAH
YLAGYQFVSYPKVLLKPKRPSFAFKAHAPTHVHTPLSAAVSRADDCLLNQDQGGCHNYTM
MWFFHTEKNECARFWYGGCGGNSNRFETQEECENLC
Download sequence
Identical sequences H3CAL4
ENSTNIP00000005284 ENSTNIP00000005286 99883.ENSTNIP00000005286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]