SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005358 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005358
Domain Number 1 Region: 187-386
Classification Level Classification E-value
Superfamily E set domains 6.53e-55
Family Arrestin/Vps26-like 0.000000965
Further Details:      
 
Domain Number 2 Region: 9-181
Classification Level Classification E-value
Superfamily E set domains 7e-53
Family Arrestin/Vps26-like 0.00000808
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005358   Gene: ENSTNIG00000002797   Transcript: ENSTNIT00000005504
Sequence length 398
Comment pep:novel chromosome:TETRAODON8:15:542633:546013:-1 gene:ENSTNIG00000002797 transcript:ENSTNIT00000005504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQTNMASKNVVFKKISKDKSVGVYLGKRDFVDRVDCVDPVDGVIIIDPEALQGRKVFVTL
SCTFRYRDDMDVMGVAFRRELYLSTTTGVPQPLQNSRSTPRARRRLLRKLGEEEFPYFNR
GFRTLTCASGEWLWQPAPHDVGNDRCAVEFEIKAFSAESQDAKVRKRSTVKLMIRKVQFA
PDTDAAAPSVETTRDFVMSDKPLHVKASLDKEVYYHGEPVKVHVSVTNSSSKNIKNIIVS
VDQVANVVLYSNDSYIKCVAIEETGDTVSPGASLQKTYSLLPLLANNRERRGIALDGKLK
HEDTNLASSSMTKAGVLKEVMGIMVSYRVTVKLVVAGMMGSSEVGLEVPFKLMHPKPDSV
RESEVEEEVEFQEFKRAYLKGMMDDEDEEGNLSGGDEM
Download sequence
Identical sequences H3CAT6
ENSTNIP00000005358 ENSTNIP00000005358 99883.ENSTNIP00000005358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]