SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005474 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005474
Domain Number 1 Region: 289-451,553-806
Classification Level Classification E-value
Superfamily Ras GEF 2.88e-103
Family Ras GEF 0.00033
Further Details:      
 
Domain Number 2 Region: 2-125
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.71e-27
Family DEP domain 0.00058
Further Details:      
 
Domain Number 3 Region: 460-562
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.77e-26
Family Ras-binding domain, RBD 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005474   Gene: ENSTNIG00000002906   Transcript: ENSTNIT00000005620
Sequence length 807
Comment pep:novel chromosome:TETRAODON8:21:725062:744733:-1 gene:ENSTNIG00000002906 transcript:ENSTNIT00000005620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CAGRAVRNAFLSHGPYPAKDKIHLARIIRRSYVGVELVQWLCEQCLYVRCRTTAVRVWQV
LLELGVLLSVDQRVVFSDSNTYYQFSFEECDSASCEFRTNEGEWPEAVRLLLQLAPYVQF
RSGGGANSPSEEDSEGNRDICSEMLQMKALERLTSTVQSELAAALARKTRKALSEQDSET
IASYITKILATMGEKPKGKTIFFVKERTEIVNRKIPLHKKCKENCFFLQSLHSFSGRLDQ
KAGEAVGRVCLKERGRDVLVLQRVKSSVTSPSDRPSPTSSGGGSREDDGDKRYVVVSGTP
LKILEHLLSDLRLDDQRGAPESRESEMLLDDFLLTYLVFMTTHDLCQALLRTYNSTRCRG
QEEGKDALFRKRKVLQLVSHWSRLYKDFLKEEEHVRSFMKTLYRCVLEDLYEFPTLEKDL
KEFQKLLRRRHTVDDCPPNQKSKQMYQQLSLKENCVPLRSSPTDTRDVICCVYVSADSYL
SVHTHPSLEAHELLRIVSLKMDRAEEEMVLAVISHSGEERRLLQPSDCVYSESLTPQGKL
VACRKDVTEILPPLTDSAELSRRPVRLLGINTWDVAAALTHLDWTLFKSIHEQELVYYTL
SRPPGTGHTVALSVLLQRCNEVQQWVMSEVLMCVSLNKRVQLLKKFIKIAAHCKAQRNLN
SAFAIIMGLNTAAVSRLNQTWEKCPGKFKKLFSELELITDPSLNHKAYREAFKRMKPPKI
PFMPLLLKDITFIHEGNKTFHDNLVNFEKLHMIADAVRMIRHCQSDQPGNEVIGVDSAEV
RASVQYLHIIDNQQTLFELSHKLEPRA
Download sequence
Identical sequences H3CB52
ENSTNIP00000005474 99883.ENSTNIP00000005474 ENSTNIP00000005474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]