SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005613 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005613
Domain Number 1 Region: 52-103
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000445
Family TSP-1 type 1 repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005613   Gene: ENSTNIG00000003043   Transcript: ENSTNIT00000005761
Sequence length 230
Comment pep:novel chromosome:TETRAODON8:10:12092973:12095869:-1 gene:ENSTNIG00000003043 transcript:ENSTNIT00000005761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMLPVLVTLQLLLPPVILVGNQMVENQNFVSFWMIQCFKTQSFQQIPSLDYWDAWGPYG
ECSRSCGSGVTTRTRRCITSRADGGHNCVGPDKSYRLCNIQDCPEGSKDFREDQCSQFDG
TDFQGNRYKWLPYYAENPCELNCMPRGENFFYRHRSAVVDGTPCHPGRRDICVEGVCKVS
PKPKPNPKMTEFNDTKRGCIAVELIIVQSDKLNVFLTVCLIRIETVLSVT
Download sequence
Identical sequences H3CBJ1
ENSTNIP00000005613 99883.ENSTNIP00000005613 ENSTNIP00000005613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]